The crystal structure of mouse PP1G in complex with truncated human PPP1R15B (631-660). Determined by X-ray diffraction at 1.61 Å resolution. Released 25 Mar 2015.
Explore 4V0V in 3D Show helices and sheets RCSB PDB PDBe
4V0V contains 25 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-17 | 9 | |
| α-helix | 32-48 | 17 | |
| β-strand | 52-55 | 4 | 1 |
| β-strand | 59-62 | 4 | 2 |
| β-strand | 64 | 1 | 3 |
| α-helix | 69-79 | 11 | |
| β-strand | 87-89 | 3 | 2 |
| α-helix | 100-113 | 14 | |
| β-strand | 118-120 | 3 | 2 |
| α-helix | 128-131 | 4 | |
| α-helix | 136-143 | 8 | |
| α-helix | 146-156 | 11 | |
| β-strand | 162-165 | 4 | 1 |
| β-strand | 169-172 | 4 | 1 |
| α-helix | 183-187 | 5 | |
| α-helix | 194-196 | 3 | |
| α-helix | 200-206 | 7 | |
| β-strand | 208-209 | 2 | 4 |
| β-strand | 216-218 | 3 | 4 |
| β-strand | 225-227 | 3 | 4 |
| α-helix | 229-239 | 11 | |
| β-strand | 243-246 | 4 | 1 |
| β-strand | 255-258 | 4 | 1 |
| β-strand | 263-266 | 4 | 1 |
| β-strand | 267 | 1 | 3 |
| α-helix | 272-274 | 3 | |
| β-strand | 280-285 | 6 | 2 |
| β-strand | 290-299 | 10 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 642-643 | 2 | 2 |
| α-helix | 646-647 | 2 | |
| β-strand | 648-653 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-16 | 8 | |
| α-helix | 17-20 | 4 | |
| α-helix | 32-48 | 17 | |
| β-strand | 52-55 | 4 | 5 |
| β-strand | 59-62 | 4 | 6 |
| β-strand | 64 | 1 | 7 |
| α-helix | 69-79 | 11 | |
| β-strand | 87-89 | 3 | 6 |
| α-helix | 100-113 | 14 | |
| β-strand | 118-120 | 3 | 6 |
| α-helix | 128-131 | 4 | |
| α-helix | 136-143 | 8 | |
| α-helix | 146-156 | 11 | |
| β-strand | 162-165 | 4 | 5 |
| β-strand | 169-172 | 4 | 5 |
| α-helix | 184-187 | 4 | |
| α-helix | 200-206 | 7 | |
| β-strand | 208-209 | 2 | 8 |
| β-strand | 216-218 | 3 | 8 |
| β-strand | 225-227 | 3 | 8 |
| α-helix | 229-239 | 11 | |
| β-strand | 243-246 | 4 | 5 |
| β-strand | 255-258 | 4 | 5 |
| β-strand | 263-266 | 4 | 5 |
| β-strand | 267 | 1 | 7 |
| α-helix | 272-274 | 3 | |
| β-strand | 280-285 | 6 | 6 |
| β-strand | 290-298 | 9 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 642-643 | 2 | 6 |
| β-strand | 648-652 | 5 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein phosphatase PP1-gamma catalytic subunit | A, C | protein | 295 | MUS MUSCULUS | P63087 (AlphaFold model) |
| Protein phosphatase 1 regulatory subunit 15B | B, D | protein | 35 | HOMO SAPIENS | Q5SWA1 (AlphaFold model) |
>4V0V_1 SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT (chains A, C) MLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNH ECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQ IRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLIC RAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
>4V0V_2 PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT 15B (chains B, D) GAMDPGRHTHVKRKKVTFLEEVTEYYISGDEDRKG
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 2 |
Water and common crystallization additives (NA) are not listed.
G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases. Chen, R., Rato, C., Yan, Y. et al. Elife (2015) 4. DOI 10.7554/eLife.04871 · PubMed
Other PDB entries of the same protein (UniProt P63087 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4V0V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.