4V2E: FLRT3 LRR domain

FLRT3 LRR domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Nov 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 5,118
Mol. weight: 75.12 kDa
Released: 5 Nov 2014

Explore 4V2E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4V2E contains 9 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	1
β-strand	41-43	3	1
β-strand	62-64	3	1
β-strand	71	1	2
α-helix	77-79	3
β-strand	87-89	3	1
β-strand	94	1	2
β-strand	97	1	3
β-strand	105	1	4
β-strand	108-110	3	1
β-strand	118	1	3
β-strand	119	1	5
α-helix	121-125	5
β-strand	129	1	4
β-strand	132-134	3	1
β-strand	145	1	5
β-strand	158-160	3	1
β-strand	179-181	3	1
α-helix	192-194	3
β-strand	203-205	3	1
β-strand	229-231	3	1
β-strand	239	1	6
β-strand	251-253	3	1
β-strand	261	1	6
β-strand	275-277	3	1
β-strand	299-301	3	1
β-strand	307-308	2	7
α-helix	315-320	6
β-strand	328-330	3	1
β-strand	333	1	8
β-strand	334-336	3	7
β-strand	344	1	8

Chain B: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	9
β-strand	41-43	3	9
β-strand	62-64	3	9
β-strand	71	1	10
α-helix	77-79	3
β-strand	87-89	3	9
β-strand	94	1	10
α-helix	99	1
β-strand	105	1	11
β-strand	108-110	3	9
α-helix	121-125	5
β-strand	129	1	11
β-strand	132-134	3	9
β-strand	158-160	3	9
β-strand	179-181	3	9
α-helix	192-195	4
β-strand	203-205	3	9
β-strand	229-231	3	9
β-strand	239	1	12
β-strand	251-253	3	9
β-strand	261	1	12
β-strand	275-277	3	9
β-strand	299-301	3	9
β-strand	307-308	2	13
α-helix	315-320	6
β-strand	328-330	3	9
β-strand	333	1	14
β-strand	334-336	3	13
β-strand	344	1	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin leucine rich transmembrane protein 3	A, B	protein	331	MUS MUSCULUS	Q8BGT1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4V2E_1 FIBRONECTIN LEUCINE RICH TRANSMEMBRANE PROTEIN 3 (chains A, B)
KSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRI
YLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEG
AFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDG
NLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFS
YLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVN
VRGLMCQAPEKVRGMAIKDLSAELFDCKDSG

Primary citation

Flrt Structure: Balancing Repulsion and Cell Adhesion in Cortical and Vascular Development. Seiradake, E., Del Toro, D., Nagel, D. et al. Neuron (2014) 84:370. DOI 10.1016/J.NEURON.2014.10.008 · PubMed

Other PDB entries of the same protein (UniProt Q8BGT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YEB 3.19 Å, Structural characterization of a synaptic adhesion complex

Browse structure collections

About this viewer

MolViewer shows 4V2E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.