FLRT3 LRR domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Nov 2014.
Explore 4V2E in 3D Show helices and sheets RCSB PDB PDBe
4V2E contains 9 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-38 | 3 | 1 |
| β-strand | 41-43 | 3 | 1 |
| β-strand | 62-64 | 3 | 1 |
| β-strand | 71 | 1 | 2 |
| α-helix | 77-79 | 3 | |
| β-strand | 87-89 | 3 | 1 |
| β-strand | 94 | 1 | 2 |
| β-strand | 97 | 1 | 3 |
| β-strand | 105 | 1 | 4 |
| β-strand | 108-110 | 3 | 1 |
| β-strand | 118 | 1 | 3 |
| β-strand | 119 | 1 | 5 |
| α-helix | 121-125 | 5 | |
| β-strand | 129 | 1 | 4 |
| β-strand | 132-134 | 3 | 1 |
| β-strand | 145 | 1 | 5 |
| β-strand | 158-160 | 3 | 1 |
| β-strand | 179-181 | 3 | 1 |
| α-helix | 192-194 | 3 | |
| β-strand | 203-205 | 3 | 1 |
| β-strand | 229-231 | 3 | 1 |
| β-strand | 239 | 1 | 6 |
| β-strand | 251-253 | 3 | 1 |
| β-strand | 261 | 1 | 6 |
| β-strand | 275-277 | 3 | 1 |
| β-strand | 299-301 | 3 | 1 |
| β-strand | 307-308 | 2 | 7 |
| α-helix | 315-320 | 6 | |
| β-strand | 328-330 | 3 | 1 |
| β-strand | 333 | 1 | 8 |
| β-strand | 334-336 | 3 | 7 |
| β-strand | 344 | 1 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-38 | 3 | 9 |
| β-strand | 41-43 | 3 | 9 |
| β-strand | 62-64 | 3 | 9 |
| β-strand | 71 | 1 | 10 |
| α-helix | 77-79 | 3 | |
| β-strand | 87-89 | 3 | 9 |
| β-strand | 94 | 1 | 10 |
| α-helix | 99 | 1 | |
| β-strand | 105 | 1 | 11 |
| β-strand | 108-110 | 3 | 9 |
| α-helix | 121-125 | 5 | |
| β-strand | 129 | 1 | 11 |
| β-strand | 132-134 | 3 | 9 |
| β-strand | 158-160 | 3 | 9 |
| β-strand | 179-181 | 3 | 9 |
| α-helix | 192-195 | 4 | |
| β-strand | 203-205 | 3 | 9 |
| β-strand | 229-231 | 3 | 9 |
| β-strand | 239 | 1 | 12 |
| β-strand | 251-253 | 3 | 9 |
| β-strand | 261 | 1 | 12 |
| β-strand | 275-277 | 3 | 9 |
| β-strand | 299-301 | 3 | 9 |
| β-strand | 307-308 | 2 | 13 |
| α-helix | 315-320 | 6 | |
| β-strand | 328-330 | 3 | 9 |
| β-strand | 333 | 1 | 14 |
| β-strand | 334-336 | 3 | 13 |
| β-strand | 344 | 1 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fibronectin leucine rich transmembrane protein 3 | A, B | protein | 331 | MUS MUSCULUS | Q8BGT1 (AlphaFold model) |
>4V2E_1 FIBRONECTIN LEUCINE RICH TRANSMEMBRANE PROTEIN 3 (chains A, B) KSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRI YLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEG AFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDG NLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFS YLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVN VRGLMCQAPEKVRGMAIKDLSAELFDCKDSG
Flrt Structure: Balancing Repulsion and Cell Adhesion in Cortical and Vascular Development. Seiradake, E., Del Toro, D., Nagel, D. et al. Neuron (2014) 84:370. DOI 10.1016/J.NEURON.2014.10.008 · PubMed
Other PDB entries of the same protein (UniProt Q8BGT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4V2E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.