4V2V: JMJD2A

JMJD2A complexed with ni(ii), nog and histone H3K27me3 peptide (25-29) ARK(me3)SA. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Nov 2014.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 6,388
Mol. weight: 90.38 kDa
Ligands: ZN, NI, OGA
Released: 5 Nov 2014

Explore 4V2V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4V2V contains 48 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	13-14	2
β-strand	15-17	3	1
α-helix	21-24	4
α-helix	27-36	10
α-helix	39-42	4
β-strand	44-47	4	1
α-helix	48-50	3
α-helix	60-62	3
β-strand	66-67	2	2
β-strand	71-78	8	3
β-strand	81-88	8	3
β-strand	92-93	2	2
α-helix	94-102	9
α-helix	108-110	3
α-helix	114-124	11
β-strand	131-132	2	3
β-strand	133-137	5	1
α-helix	158-164	7
β-strand	169	1	4
β-strand	175-179	5	1
β-strand	184-188	5	5
α-helix	189-190	2
α-helix	191-193	3
β-strand	195-203	9	1
β-strand	206-211	6	5
α-helix	213-215	3
α-helix	216-226	11
α-helix	228-233	6
α-helix	237-240	4
β-strand	243-245	3	3
α-helix	247-252	6
β-strand	258-262	5	5
β-strand	267-270	4	1
β-strand	275-280	6	5
β-strand	284-291	8	1
α-helix	296-302	7
α-helix	318-324	7
α-helix	326-328	3
α-helix	329-334	6
α-helix	339-341	3
α-helix	345-347	3
α-helix	348-350	3
α-helix	351-354	4

Chain B: 22 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	15-17	3	6
α-helix	21-24	4
α-helix	27-36	10
α-helix	39-42	4
β-strand	44-47	4	6
α-helix	48-50	3
β-strand	66-67	2	7
β-strand	71-78	8	8
β-strand	81-88	8	8
β-strand	92-93	2	7
α-helix	94-102	9
α-helix	108-110	3
α-helix	114-124	11
β-strand	131-132	2	8
β-strand	133-137	5	6
α-helix	156-158	3
α-helix	159-162	4
β-strand	169	1	9
β-strand	175-179	5	6
β-strand	184-188	5	10
α-helix	189-190	2
α-helix	191-193	3
β-strand	195-203	9	6
β-strand	206-211	6	10
α-helix	213-215	3
α-helix	216-226	11
α-helix	228-233	6
α-helix	237-240	4
β-strand	243-245	3	8
α-helix	247-252	6
β-strand	258-262	5	10
β-strand	267-270	4	6
β-strand	275-280	6	10
β-strand	284-291	8	6
α-helix	296-302	7
α-helix	318-324	7
α-helix	326-333	8
α-helix	339-341	3
α-helix	345-347	3
α-helix	348-350	3

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	26	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lysine-specific demethylase 4A	A, B	protein	381	HOMO SAPIENS	O75164 (AlphaFold model)
Histone H3.1T	C, D	protein	5	HOMO SAPIENS	Q16695 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4V2V_1 LYSINE-SPECIFIC DEMETHYLASE 4A (chains A, B)
MHHHHHHSSGVDLGTENLYFQSMASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQG
AHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFR
KIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILD
LVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKR
LERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAG
FNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDN
TVIDHTLPTPEAAEFLKESEL

Sequence of entity 2 (C, D), FASTA

>4V2V_2 HISTONE H3.1T (chains C, D)
ARKSA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
NI	Nickel (II) ion	Ni	2
OGA	N-oxalylglycine	C4 H5 N O5	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Studies on the Catalytic Domains of Multiple Jmjc Oxygenases Using Peptide Substrates. Williams, S.T., Walport, L.J., Hopkinson, R.J. et al. Epigenetics (2014) 9:1596. DOI 10.4161/15592294.2014.983381 · PubMed

Other PDB entries of the same protein (UniProt O75164 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GP4 1.59 Å, Jumonji domain-containing protein 2A with crystallization epitope mutations Q953E:A958D
9GII 1.7 Å, Jumonji domain-containing protein 2A with crystallization epitope mutation R913A
6G5X 1.78 Å, Crystal Structure of KDM4A with compound YP-02-145
2QQR 1.8 Å, JMJD2A hybrid tudor domains
4V2W 1.81 Å, JMJD2A complexed with ni(ii), nog and histone H3K27me3 peptide (16-35)
5VAR 1.83 Å, Crystal structure of KDM4A tandem TUDOR domain in complex with a tri-methyl lysine…
6G5W 1.83 Å, Crystal Structure of KDM4A with compound YP-03-038
9GLE 1.88 Å, Jumonji domain-containing protein 2A with crystallization epitope mutations A91T:T93S
2OX0 1.95 Å, Crystal structure of JMJD2A complexed with histone H3 peptide dimethylated at Lys9
6H8P 1.98 Å, JMJD2A/ KDM4A COMPLEXED WITH NI(II), NOG AND Histone H1.4(18-32)K26me3 peptide (15-mer)
3PDQ 1.99 Å, Crystal structure of JMJD2A complexed with bipyridyl inhibitor
2P5B 1.99 Å, The complex structure of JMJD2A and trimethylated H3K36 peptide

Browse structure collections

About this viewer

MolViewer shows 4V2V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.