The CIDRa domain from IT4var07 PfEMP1 bound to endothelial protein C receptor. Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Dec 2014.
Explore 4V3E in 3D Show helices and sheets RCSB PDB PDBe
4V3E contains 18 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 500-505 | 6 | 1 |
| α-helix | 516-519 | 4 | |
| α-helix | 521-525 | 5 | |
| β-strand | 537-542 | 6 | 1 |
| β-strand | 548-551 | 4 | 1 |
| β-strand | 565-566 | 2 | 1 |
| α-helix | 568-590 | 23 | |
| α-helix | 605-628 | 24 | |
| α-helix | 634-636 | 3 | |
| α-helix | 639-641 | 3 | |
| α-helix | 645-651 | 7 | |
| α-helix | 653-657 | 5 | |
| α-helix | 663-677 | 15 | |
| α-helix | 693-710 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-21 | 12 | 2 |
| β-strand | 24-33 | 10 | 2 |
| β-strand | 36-44 | 9 | 2 |
| β-strand | 49-52 | 4 | 2 |
| α-helix | 59-87 | 29 | |
| β-strand | 93-102 | 10 | 2 |
| α-helix | 110 | 1 | |
| β-strand | 111-118 | 8 | 2 |
| β-strand | 121-127 | 7 | 2 |
| β-strand | 132-135 | 4 | 2 |
| α-helix | 142-151 | 10 | |
| α-helix | 155 | 1 | |
| α-helix | 156-160 | 5 | |
| α-helix | 161-163 | 3 | |
| α-helix | 164-168 | 5 | |
| α-helix | 169-176 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| IT4VAR07 cidra | A | protein | 251 | PLASMODIUM FALCIPARUM | |
| Endothelial protein C receptor | B | protein | 171 | HOMO SAPIENS | Q9UNN8 (AlphaFold model) |
>4V3E_1 IT4VAR07 CIDRA (chains A) PDCGVICENGKCVVKENGSNCRHYNIYEPAPDVKTTEINVIVSGDEQGIITKKLQDFCMN PNNENGTNNQIWKCYYKDEKEDKCKVETKSGNSTYKEKITSFDEFFDFWVRKLLIDTIKW ETELTYCINNTTNADCNNECNKNCVCFDKWVKQKEKEWKNIMDLFTNKHDIPKKYYLNIN DLFNSFFFQVIYKFNEGEAKWNKLKENLKKKTESSKKNKGTKDSEAAIKVLFDHLKETAT ICKDNNTNEAC
>4V3E_2 ENDOTHELIAL PROTEIN C RECEPTOR (chains B) LQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQS GLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFR PERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHIS
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| PTY | Phosphatidylethanolamine | C40 H80 N O8 P | 1 |
Structural Conservation Despite Huge Sequence Diversity Allows Epcr Binding by the Pfemp1 Family Implicated in Severe Childhood Malaria. Lau, C.K.Y., Turner, L., Jespersen, J.S. et al. Cell Host Microbe (2015) 17:118. DOI 10.1016/J.CHOM.2014.11.007 · PubMed
Other PDB entries of the same protein (UniProt Q9UNN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4V3E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.