Structure and receptor binding prefereneces of recombinant human A(H3N2) virus hemagglutinins. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Feb 2015.
Explore 4WEA in 3D Show helices and sheets RCSB PDB PDBe
4WEA contains 12 α-helices and 48 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-17 | 7 | 1 |
| β-strand | 18 | 1 | 2 |
| β-strand | 24-26 | 3 | 3 |
| β-strand | 34-36 | 3 | 3 |
| β-strand | 39-41 | 3 | 4 |
| β-strand | 43-44 | 2 | 5 |
| β-strand | 51-54 | 4 | 6 |
| β-strand | 58-60 | 3 | 7 |
| α-helix | 66-71 | 6 | |
| α-helix | 74-79 | 6 | |
| β-strand | 83 | 1 | 8 |
| β-strand | 86-89 | 4 | 7 |
| β-strand | 100-101 | 2 | 9 |
| α-helix | 105-115 | 11 | |
| β-strand | 117 | 1 | 8 |
| β-strand | 120-122 | 3 | 9 |
| β-strand | 130-131 | 2 | 10 |
| β-strand | 136-140 | 5 | 11 |
| β-strand | 145-146 | 2 | 11 |
| β-strand | 151-153 | 3 | 9 |
| β-strand | 155-156 | 2 | 10 |
| β-strand | 157 | 1 | 12 |
| β-strand | 160 | 1 | 12 |
| β-strand | 164-169 | 6 | 13 |
| β-strand | 176-184 | 9 | 9 |
| α-helix | 188-195 | 8 | |
| β-strand | 202-206 | 5 | 13 |
| β-strand | 209-213 | 5 | 13 |
| β-strand | 223 | 1 | 14 |
| β-strand | 226 | 1 | 14 |
| β-strand | 229-237 | 9 | 9 |
| β-strand | 242-247 | 6 | 13 |
| β-strand | 251-254 | 4 | 9 |
| β-strand | 256-259 | 4 | 9 |
| β-strand | 266-269 | 4 | 7 |
| α-helix | 272-273 | 2 | |
| β-strand | 274-278 | 5 | 6 |
| β-strand | 281-283 | 3 | 15 |
| β-strand | 286-288 | 3 | 15 |
| β-strand | 294-295 | 2 | 5 |
| β-strand | 302 | 1 | 15 |
| β-strand | 303-305 | 3 | 16 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 5 |
| β-strand | 315-317 | 3 | 4 |
| α-helix | 320 | 1 | |
| β-strand | 321 | 1 | 3 |
| α-helix | 322 | 1 | |
| β-strand | 335 | 1 | 17 |
| β-strand | 339 | 1 | 17 |
| β-strand | 343 | 1 | 2 |
| β-strand | 351-357 | 7 | 1 |
| β-strand | 360-366 | 7 | 1 |
| α-helix | 367-384 | 18 | |
| β-strand | 389-391 | 3 | 16 |
| α-helix | 405-455 | 51 | |
| β-strand | 459-461 | 3 | 1 |
| β-strand | 466-469 | 4 | 1 |
| α-helix | 475-482 | 8 | |
| α-helix | 488-499 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemagglutinin | A | protein | 515 | Influenza A virus | R9U684 |
>4WEA_1 Hemagglutinin (chains A) ADLGSQKLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQNSSIGEICDSP HQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASS GTLEFNNESFNWTGVTQNGTSSACIRRSNNSFFSRLNWLTHLNFKYPALNVTMPNNEQFD KLYIWGVHHPGTDKDQIFLYAQSSGRITVSTKRSQQAVIPNIGSRPRIRNIPSRISIYWT IVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQ NVNRITYGACPRYVKQSTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRH QNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVED TKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDN ACIGSIRNGTYDHDVYRDEALNNRFQIKSGRLVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| SIA | N-acetyl-alpha-neuraminic acid | C11 H19 N O9 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 7 |
Structure and receptor binding preferences of recombinant human A(H3N2) virus hemagglutinins. Yang, H., Carney, P.J., Chang, J.C. et al. Virology (2015) 477C:18-31. DOI 10.1016/j.virol.2014.12.024 · PubMed
Other PDB entries of the same protein (UniProt R9U684), best resolution first:
MolViewer shows 4WEA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.