Crystal structure of cAMP-dependent Protein Kinase A from Cricetulus griseus. Determined by X-ray diffraction at 1.14 Å resolution. Released 22 Oct 2014.
Explore 4WIH in 3D Show helices and sheets RCSB PDB PDBe
4WIH contains 18 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-32 | 30 | |
| α-helix | 34-36 | 3 | |
| α-helix | 41-43 | 3 | |
| β-strand | 44-52 | 9 | 1 |
| β-strand | 56-63 | 8 | 1 |
| β-strand | 69-76 | 8 | 1 |
| α-helix | 77-82 | 6 | |
| α-helix | 86-98 | 13 | |
| β-strand | 104 | 1 | 2 |
| α-helix | 105-106 | 2 | |
| β-strand | 107-112 | 6 | 1 |
| β-strand | 116-122 | 7 | 1 |
| β-strand | 128 | 1 | 2 |
| α-helix | 129-136 | 8 | |
| α-helix | 141-160 | 20 | |
| β-strand | 163-164 | 2 | 3 |
| α-helix | 170-172 | 3 | |
| β-strand | 173-175 | 3 | 2 |
| β-strand | 181-183 | 3 | 2 |
| β-strand | 190-191 | 2 | 3 |
| β-strand | 196 | 1 | 4 |
| β-strand | 201 | 1 | 5 |
| α-helix | 203-205 | 3 | |
| α-helix | 208-211 | 4 | |
| β-strand | 216 | 1 | 4 |
| α-helix | 219-234 | 16 | |
| α-helix | 244-253 | 10 | |
| α-helix | 264-273 | 10 | |
| α-helix | 290-293 | 4 | |
| α-helix | 296-298 | 3 | |
| α-helix | 303-307 | 5 | |
| α-helix | 312-313 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-dependent protein kinase catalytic subunit alpha | A | protein | 353 | Cricetulus griseus | P25321 (AlphaFold model) |
| cAMP Dependent Protein Kinase Inhibitor PKI-tide | B | protein | 19 | synthetic construct | G3HK48 (AlphaFold model) |
>4WIH_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A) GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRV MLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLY MVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWF ATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
>4WIH_2 cAMP Dependent Protein Kinase Inhibitor PKI-tide (chains B) IAAGRTGRRQAIHDILVAA
High-resolution crystal structure of cAMP-dependent protein kinase from Cricetulus griseus. Kudlinzki, D., Linhard, V.L., Saxena, K. et al. Acta Crystallogr F Struct Biol Commun (2015) 71:1088-1093. DOI 10.1107/S2053230X1501242X · PubMed
Other PDB entries of the same protein (UniProt P25321 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WIH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.