Netrin 4 lacking the C-terminal Domain. Determined by X-ray diffraction at 2.72 Å resolution. Released 10 Feb 2016.
Explore 4WNX in 3D Show helices and sheets RCSB PDB PDBe
4WNX contains 19 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 36-38 | 3 | |
| β-strand | 39-40 | 2 | 1 |
| β-strand | 47-49 | 3 | 1 |
| β-strand | 59-62 | 4 | 2 |
| β-strand | 66 | 1 | 3 |
| β-strand | 71 | 1 | 4 |
| β-strand | 72 | 1 | 3 |
| α-helix | 73-76 | 4 | |
| β-strand | 77-80 | 4 | 2 |
| α-helix | 91-93 | 3 | |
| β-strand | 106-107 | 2 | 1 |
| α-helix | 108-109 | 2 | |
| β-strand | 115-134 | 20 | 1 |
| α-helix | 137-139 | 3 | |
| β-strand | 141-147 | 7 | 1 |
| β-strand | 155-161 | 7 | 1 |
| α-helix | 164-167 | 4 | |
| β-strand | 172 | 1 | 1 |
| α-helix | 173-176 | 4 | |
| β-strand | 181-182 | 2 | 1 |
| β-strand | 195-199 | 5 | 1 |
| α-helix | 203-206 | 4 | |
| α-helix | 213-219 | 7 | |
| β-strand | 220-230 | 11 | 1 |
| β-strand | 237 | 1 | 4 |
| β-strand | 252-262 | 11 | 1 |
| β-strand | 271-272 | 2 | 5 |
| α-helix | 273-274 | 2 | |
| α-helix | 288-290 | 3 | |
| β-strand | 292-293 | 2 | 5 |
| β-strand | 299-300 | 2 | 6 |
| β-strand | 306-307 | 2 | 6 |
| α-helix | 308 | 1 | |
| α-helix | 328-333 | 6 | |
| β-strand | 341-343 | 3 | 7 |
| α-helix | 345-350 | 6 | |
| β-strand | 357-359 | 3 | 7 |
| β-strand | 366 | 1 | 8 |
| β-strand | 374 | 1 | 8 |
| α-helix | 375 | 1 | |
| β-strand | 378-380 | 3 | 9 |
| α-helix | 389-391 | 3 | |
| β-strand | 392-394 | 3 | 9 |
| β-strand | 402 | 1 | 10 |
| β-strand | 422 | 1 | 10 |
| α-helix | 423 | 1 | |
| β-strand | 426-427 | 2 | 11 |
| β-strand | 433-434 | 2 | 11 |
| α-helix | 435 | 1 | |
| β-strand | 438-442 | 5 | 12 |
| β-strand | 445-448 | 4 | 12 |
| α-helix | 449 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Netrin-4 | A | protein | 433 | Mus musculus | Q9JI33 (AlphaFold model) |
>4WNX_1 Netrin-4 (chains A) CEKACNPRMGNLALGRKLRADTMCGQNATELFCFYSENADLTCRQPKCDKCNAAHSHLAH PPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIMVFKSPRPAAMVLDRSQD FGKTWKPYKYFATNCSATFGLEDDVVKKGAICTSRYSNPFPCTGGEVIFRALSPPYDIEN PYSAKVQEQLKITNLRVRLLKRQSCPCQINDLNAKPHHFMHYAVYDFIVKGSCFCNGHAD QCLPVEGFRPIKAPGAFHVVHGRCMCKHNTAGSHCQHCAPLYNDRPWEAADGRTGAPNEC RTCKCNGHADTCHFDVNVWEASGNRSGGVCNNCQHNTEGQHCQRCKPGFYRDLRRPFSAP DACKACSCHPVGSAILPFSSVTFCDPSNGDCPCKPGVAGPHCDRCMVGYWGFGDYGCRPC DCAGSCDPLTGDC
| ID | Name | Formula | Copies |
|---|---|---|---|
| TAM | Tris(hydroxyethyl)aminomethane | C7 H17 N O3 | 1 |
| CA | Calcium ion | Ca | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Structural decoding of netrin-4 reveals a regulatory function towards mature basement membranes. Reuten, R., Patel, T.R., McDougall, M. et al. Nat Commun (2016) 7:13515-13515. DOI 10.1038/ncomms13515 · PubMed
Other PDB entries of the same protein (UniProt Q9JI33 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WNX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.