Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with 6-aminouracil, Form IV. Determined by X-ray diffraction at 1.4 Å resolution. Released 15 Jul 2015.
Explore 4WS3 in 3D Show helices and sheets RCSB PDB PDBe
4WS3 contains 16 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-9 | 4 | |
| α-helix | 12-17 | 6 | |
| α-helix | 19-21 | 3 | |
| α-helix | 22-37 | 16 | |
| β-strand | 43 | 1 | 1 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-54 | 4 | |
| α-helix | 57-59 | 3 | |
| β-strand | 62-66 | 5 | 2 |
| α-helix | 90-91 | 2 | |
| α-helix | 92-105 | 14 | |
| α-helix | 107-110 | 4 | |
| α-helix | 116-120 | 5 | |
| β-strand | 123-127 | 5 | 2 |
| β-strand | 132 | 1 | 1 |
| β-strand | 133 | 1 | 3 |
| β-strand | 136 | 1 | 3 |
| α-helix | 145-157 | 13 | |
| β-strand | 163-167 | 5 | 2 |
| α-helix | 172-179 | 8 | |
| β-strand | 185-187 | 3 | 2 |
| α-helix | 194-199 | 6 | |
| α-helix | 206-216 | 11 | |
| α-helix | 219-222 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A | protein | 238 | Mycobacterium tuberculosis | P9WFQ9 (AlphaFold model) |
>4WS3_1 Uracil-DNA glycosylase (chains A) MHHHHHHGMASMTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNV LRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPL PSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWG RDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP
| ID | Name | Formula | Copies |
|---|---|---|---|
| 6UA | 6-aminopyrimidine-2,4(3H,5H)-dione | C4 H5 N3 O2 | 1 |
Water and common crystallization additives (CL, DMS) are not listed.
Structural plasticity in Mycobacterium tuberculosis uracil-DNA glycosylase (MtUng) and its functional implications. Arif, S.M., Geethanandan, K., Mishra, P. et al. Acta Crystallogr D Biol Crystallogr (2015) 71:1514-1527. DOI 10.1107/S1399004715009311 · PubMed
Other PDB entries of the same protein (UniProt P9WFQ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WS3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.