4WSB: Polymerase PA

Bat Influenza A polymerase with bound vRNA promoter. Determined by X-ray diffraction at 2.65 Å resolution. Released 19 Nov 2014.

Method: X-ray diffraction
Resolution: 2.65 Å
Organisms: Influenza A virus, unidentified influenza virus
Chains: 5
Atoms: 18,185
Mol. weight: 274.86 kDa
Ligands: ZN, PO4
Released: 19 Nov 2014

Explore 4WSB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WSB contains 109 α-helices and 102 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	11-21	11
α-helix	32-49	18
β-strand	52-54	3	1
β-strand	60-62	3	1
β-strand	73-74	2	1
β-strand	76-78	3	2
β-strand	80	1	3
β-strand	82	1	3
α-helix	84-96	13
α-helix	100-103	4
β-strand	109-111	3	2
β-strand	116-121	6	2
α-helix	128-138	11
β-strand	144-147	4	2
β-strand	155-156	2	2
α-helix	157-159	3
α-helix	165-184	20
α-helix	209-218	10
α-helix	220	1
α-helix	226-234	9
α-helix	241-248	8
β-strand	258-259	2	4
α-helix	265-268	4
β-strand	275	1	5
α-helix	276-278	3
β-strand	290-293	4	6
α-helix	303-312	10
β-strand	317-324	8	6
α-helix	331-346	16
β-strand	354-355	2	7
α-helix	359-364	6
α-helix	371	1
β-strand	372-375	4	8
α-helix	376-379	4
β-strand	385-387	3	8
α-helix	388-389	2
α-helix	391-395	5
β-strand	397	1	5
α-helix	401-409	9
β-strand	412	1	9
β-strand	415-416	2	6
α-helix	420-422	3
α-helix	424-426	3
α-helix	429-446	18
β-strand	448	1	9
α-helix	449-470	22
β-strand	475-476	2	7
β-strand	477-486	10	6
β-strand	491-501	11	6
β-strand	512-521	10	6
α-helix	525-528	4
β-strand	536-546	11	6
β-strand	551-566	16	6
α-helix	567-574	8
α-helix	576-578	3
α-helix	579-598	20
α-helix	603-608	6
β-strand	614-618	5	10
β-strand	623-626	4	10
α-helix	628-644	17
α-helix	648-668	21
β-strand	674-675	2	4
α-helix	678-686	9
α-helix	693-713	21

Chain B: 38 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	10
α-helix	5-10	6
α-helix	15-21	7
α-helix	27-29	3
α-helix	36-49	14
β-strand	54-57	4	11
β-strand	64-67	4	11
α-helix	72-74	3
α-helix	85-98	14
α-helix	102-116	15
α-helix	119-122	4
β-strand	128-130	3	12
β-strand	135-137	3	12
α-helix	139-152	14
α-helix	158-160	3
α-helix	163-172	10
β-strand	179-191	13	13
β-strand	200-212	13	13
α-helix	214-221	8
β-strand	223-224	2	14
β-strand	225-228	4	15
β-strand	240-243	4	15
β-strand	245	1	12
α-helix	246-263	18
β-strand	269	1	4
α-helix	275-292	18
β-strand	298-305	8	4
β-strand	306	1	16
α-helix	315-326	12
α-helix	331-345	15
β-strand	348-349	2	14
β-strand	355-359	5	8
β-strand	364-368	5	8
α-helix	370-373	4
α-helix	383-393	11
β-strand	396-397	2	14
β-strand	400-402	3	14
α-helix	415-425	11
α-helix	429-432	4
β-strand	436-443	8	4
β-strand	446-453	8	4
α-helix	456-471	16
β-strand	477	1	16
β-strand	483-486	4	4
β-strand	489	1	17
β-strand	497	1	18
β-strand	498	1	17
β-strand	501	1	18
α-helix	506-511	6
α-helix	519-536	18
α-helix	541-559	19
α-helix	573-582	10
α-helix	586-588	3
α-helix	591-593	3
α-helix	601-603	3
α-helix	608-611	4
α-helix	613-615	3
α-helix	618-624	7
β-strand	642-645	4	19
β-strand	653-656	4	19
β-strand	668	1	20
α-helix	669-671	3
α-helix	673-675	3
α-helix	678-680	3
α-helix	681-699	19
α-helix	701-704	4
β-strand	713	1	21
α-helix	714-731	18
α-helix	737-752	16

Chain C: 36 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	14-22	9
β-strand	24	1	21
α-helix	27-32	6
α-helix	43-50	8
β-strand	57-60	4	20
α-helix	63-66	4
β-strand	70	1	22
β-strand	76	1	22
β-strand	78-82	5	20
α-helix	83	1
β-strand	88-91	4	20
α-helix	93-102	10
α-helix	111-114	4
α-helix	116-126	11
β-strand	129-135	7	23
β-strand	141-146	6	24
α-helix	156-167	12
α-helix	180-192	13
α-helix	200-211	12
β-strand	215-220	6	24
α-helix	226-229	4
α-helix	232-235	4
β-strand	236	1	23
β-strand	240-245	6	23
α-helix	249-251	3
α-helix	252-272	21
α-helix	276-286	11
β-strand	288-289	2	25
β-strand	293	1	25
α-helix	294-300	7
α-helix	306-315	10
α-helix	317-319	3
β-strand	322-325	4	26
β-strand	328-334	7	26
β-strand	338-345	8	27
β-strand	351-358	8	27
β-strand	361-367	7	26
β-strand	370-377	8	26
β-strand	380-388	9	26
α-helix	391-404	14
α-helix	408-412	5
β-strand	422	1	28
β-strand	426	1	28
α-helix	430-438	9
α-helix	443-449	7
β-strand	451-453	3	29
β-strand	461	1	26
β-strand	462-463	2	30
β-strand	469-470	2	30
β-strand	473-475	3	29
β-strand	478-480	3	26
β-strand	496-498	3	31
β-strand	504-506	3	31
β-strand	511-513	3	31
α-helix	515-517	3
α-helix	523-525	3
β-strand	529-530	2	25
α-helix	542-555	14
α-helix	557-565	9
α-helix	568-572	5
α-helix	578-581	4
α-helix	586-588	3
α-helix	589-605	17
α-helix	612-618	7
α-helix	619-622	4
β-strand	635-639	5	32
β-strand	644-648	5	32
β-strand	657-659	3	33
β-strand	664-667	4	33
β-strand	670-673	4	33
α-helix	674-675	2
β-strand	694-699	6	34
α-helix	702-704	3
β-strand	708	1	34
β-strand	721-727	7	34
β-strand	730-736	7	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase PA	A	protein	738	Influenza A virus	H6QM92
RNA-directed RNA polymerase catalytic subunit	B	protein	776	Influenza A virus	H6QM91
Polymerase PB2	C	protein	787	Influenza A virus	H6QM90
Influenza A polymerase vRNA promoter 3' end	R	RNA	18	unidentified influenza virus
Influenza A polymerase vRNA promoter 5' end	V	RNA	16	unidentified influenza virus

Sequence of entity 1 (A), FASTA

>4WSB_1 Polymerase PA (chains A)
GSHHHHHHHHGSGSMENFVRTNFNPMILERAEKTMKEYGENPQNEGNKFAAISTHMEVCF
MYSDFHFIDLEGNTIVKENDDDNAMLKHRFEIIEGQERNIAWTIVNSICNMTENSKPRFL
PDLYDYKTNKFIEIGVTRRKVEDYYYEKASKLKGENVYIHIFSFDGEEMATDDEYILDEE
SRARIKTRLFVLRQELATAGLWDSFRQSEKGEETLEEEFSYPPTFQRLANQSLPPSFKDY
HQFKAYVSSFKANGNIEAKLGAMSEKVNAQIESFDPRTIRELELPEGKFCTQRSKFLLMD
AMKLSVLNPAHEGEGIPMKDAKACLDTFWGWKKATIIKKHEKGVNTNYLMIWEQLLESIK
EMEGKFLNLKKTNHLKWGLGEGQAPEKMDFEDCKEVPDLFQYKSEPPEKRKLASWIQSEF
NKASELTNSNWIEFDELGNDVAPIEHIASRRRNFFTAEVSQCRASEYIMKAVYINTALLN
SSCTAMEEYQVIPIITKCRDTSGQRRTNLYGFIIKGRSHLRNDTDVVNFISLEFSLTDPR
NEIHKWEKYCVLEIGDMEIRTSISTIMKPVYLYVRTNGTSKIKMKWGMEMRRCLLQSLQQ
VESMIEAESAVKEKDMTEPFFRNRENDWPIGESPQGIEKGTIGKVCRVLLAKSVFNSIYA
SAQLEGFSAESRKLLLLIQAFRDNLDPGTFDLKGLYEAIEECIINDPWVLLNASWFNSFL
KAVQLSMGSGSGENLYFQ

Sequence of entity 2 (B), FASTA

>4WSB_2 RNA-directed RNA polymerase catalytic subunit (chains B)
GSGSGSGSGMDVNPMLIFLKVPVQNAISTTFPYTGDPPYSHGTGTGYTMDTVIRTHDYSS
RGIWKTNSETGAQQLNPIDGPLPEDNEPSGYAQTDCVLELIEGLDRSHPGLFETACQETI
DAIQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRKNGYKLNESGRLIDFLKDVL
LSFENDSMEVTTHFQKKKRIRDNHSKKMITQRTIGKKRVKLTKKNYLIRALTLNTMTKDA
ERGKLKRRAIATPGMQIRGFVYFVELLARNICERLEQSGLPVGGNEKKAKLANVIKKMMA
KSTDEELSYTITGDNTKWNENQNPRIFLAMVLRITAGQPEWFRDLLAVAPIMFSNKVARL
GRGYMFESKSMHLRTQISAENLSDINLRYFNEDTKKKIEKIRHLMVEGTASLSPGMMMGM
FNMLSTVLGVSVLNLGQREILKRTYWWDGLQSSDDFALIINGHFKEDIQQGVNHFYRTCK
LVGINMSQKKSYINKTGTFEFTSFFYRYGFVANFSMELPSFGVAGNNESADMSIGTTVIK
TNMINNDLGPATAQMAIQLFIKDYRYTYRCHRGDTNLETRRTKSIKRLWTETISKAGLLV
ADGGPNPYNLRNLHIPEVCLKWSLMDPDYRGRLCNPNNPFVHHMEVESTNLAVVMPAHGP
AKSLEYDAVATTHSWTPKRNRSILNTNQRGILEDERIYQKCCQVFEKFFPSSTYRRPIGM
ASMLDAMLSRARIDARIDLESGRISSQDFSEITNTCKAIEALKRQGSGSGENLYFQ

Sequence of entity 3 (C), FASTA

>4WSB_3 Polymerase PB2 (chains C)
GSGSGSGSMERIKELMEMVKNSRMREILTTTSVDHMAVIKKYTSGRQEKNPALRMKWMMA
MKYPISASSRIREMIPEKDEDGNTLWTNTKDAGSNRVLVSPNAVTWWNRAGPVSDVVHYP
RVYKMYFDRLERLTHGTFGPVKFYNQVKVRKRVDINPGHKDLTSREAQEVIMEVVFPNEV
GARTLSSDAQLTITKEKKEELKNCKISPIMVAYMLERELVRRTRFLPIAGATSSTYVEVL
HLTQGTCWEQQYTPGGEAENDDLDQTLIIASRNIVRRSIVAIDPLASLLSMCHTTSISSE
PLVEILRSNPTDEQAVNICKAALGIRINNSFSFGGYNFKRVKGSSQRTEKAVLTGNLQTL
TMTIFEGYEEFNVSGKRASAVLKKGAQRLIQAIIGGRTLEDILNLMITLMVFSQEEKMLK
AVRGDLNFVNRANQRLNPMYQLLRHFQKDSSTLLKNWGTEEIDPIMGIAGIMPDGTINKT
QTLMGVRLSQGGVDEYSFNERIRVNIDKYLRVRNEKGELLISPEEVSEAQGQEKLPINYN
SSLMWEVNGPESILTNTYHWIIKNWELLKTQWMTDPTVLYNRIEFEPFQTLIPKGNRAIY
SGFTRTLFQQMRDVEGTFDSIQIIKLLPFSAHPPSLGRTQFSSFTLNIRGAPLRLLIRGN
SQVFNYNQMENVIIVLGKSVGSPERSILTESSSIESAVLRGFLILGKANSKYGPVLTIGE
LDKLGRGEKANVLIGQGDTVLVMKRKRDSSILTDSQTALKRIRLEESKGWSHPQFEKGSG
SENLYFQ

Sequence of entity 4 (R), FASTA

>4WSB_4 Influenza A polymerase vRNA promoter 3' end (chains R)
UAUACCUCUGCUUCUGCU

Sequence of entity 5 (V), FASTA

>4WSB_5 Influenza A polymerase vRNA promoter 5' end (chains V)
AGUAGUAACAAGAGGG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
PO4	Phosphate ion	O4 P	16

Primary citation

Structural insight into cap-snatching and RNA synthesis by influenza polymerase. Reich, S., Guilligay, D., Pflug, A. et al. Nature (2014) 516:361-366. DOI 10.1038/nature14009 · PubMed

Other PDB entries of the same protein (UniProt H6QM92), best resolution first:

9F37 1.91 Å, Replication-like initiation state of influenza polymerase with GTP and CTP at…
9F2R 1.96 Å, Influenza A/H17N10 polymerase with bound promoter and 3' end of template in active site
6SZU 2.41 Å, Bat Influenza A polymerase pre-termination complex with pyrophosphate using 44-mer vRNA…
5M3H 2.5 Å, Bat influenza A/H17N10 polymerase bound to four heptad repeats of serine 5…
6SZV 2.5 Å, Bat Influenza A polymerase elongation complex with incoming UTP analogue (core +…
6T0N 2.54 Å, Bat Influenza A polymerase pre-initiation complex
4NFZ 2.7 Å, Crystal structure of polymerase subunit PA N-terminal endonuclease domain from…
6FHH 2.7 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter bound to…
6TW1 2.7 Å, Bat Influenza A polymerase termination complex with pyrophosphate using 44-mer vRNA…
6FHI 2.8 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter bound to…
6T0R 2.82 Å, Bat Influenza A polymerase product dissociation complex using 44-mer vRNA template with…
6EVK 2.9 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter and cap…

Browse structure collections

About this viewer

MolViewer shows 4WSB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.