Ataxin-3 Carboxy Terminal Region - Crystal C2 (triclinic). Determined by X-ray diffraction at 2.25 Å resolution. Released 9 Mar 2016.
Explore 4WTH in 3D Show helices and sheets RCSB PDB PDBe
4WTH contains 46 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-10 | 5 | 1 |
| α-helix | 17-31 | 15 | |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 43-50 | 8 | |
| β-strand | 59-63 | 5 | 1 |
| α-helix | 64-66 | 3 | |
| α-helix | 67-72 | 6 | |
| β-strand | 76 | 1 | 2 |
| α-helix | 77-79 | 3 | |
| α-helix | 83-86 | 4 | |
| β-strand | 89 | 1 | 3 |
| α-helix | 91-96 | 6 | |
| β-strand | 98-99 | 2 | 4 |
| β-strand | 102-103 | 2 | 4 |
| β-strand | 106-111 | 6 | 1 |
| β-strand | 114-118 | 5 | 5 |
| β-strand | 128 | 1 | 6 |
| α-helix | 132-140 | 9 | |
| β-strand | 145-147 | 3 | 5 |
| α-helix | 154-163 | 10 | |
| β-strand | 167-172 | 6 | 7 |
| β-strand | 175-182 | 8 | 7 |
| α-helix | 186-200 | 15 | |
| α-helix | 210-219 | 10 | |
| β-strand | 222-227 | 6 | 5 |
| α-helix | 229-231 | 3 | |
| α-helix | 232-238 | 7 | |
| β-strand | 242-245 | 4 | 5 |
| α-helix | 246-248 | 3 | |
| β-strand | 249 | 1 | 6 |
| β-strand | 250 | 1 | 8 |
| β-strand | 253 | 1 | 8 |
| α-helix | 254-255 | 2 | |
| β-strand | 258-259 | 2 | 9 |
| β-strand | 260-266 | 7 | 1 |
| β-strand | 267 | 1 | 2 |
| α-helix | 273-279 | 7 | |
| α-helix | 280-284 | 5 | |
| α-helix | 287-296 | 10 | |
| β-strand | 301-302 | 2 | 1 |
| β-strand | 304 | 1 | 3 |
| α-helix | 305-310 | 6 | |
| α-helix | 315-326 | 12 | |
| β-strand | 328-329 | 2 | 9 |
| α-helix | 330-331 | 2 | |
| α-helix | 336-351 | 16 | |
| α-helix | 357-396 | 40 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-10 | 4 | 10 |
| α-helix | 17-31 | 15 | |
| β-strand | 35-38 | 4 | 10 |
| α-helix | 43-51 | 9 | |
| β-strand | 59-63 | 5 | 10 |
| α-helix | 64-66 | 3 | |
| α-helix | 67-72 | 6 | |
| β-strand | 76 | 1 | 11 |
| α-helix | 77-79 | 3 | |
| α-helix | 83-86 | 4 | |
| β-strand | 89 | 1 | 12 |
| α-helix | 91-95 | 5 | |
| β-strand | 98-99 | 2 | 13 |
| β-strand | 102-103 | 2 | 13 |
| β-strand | 106-111 | 6 | 10 |
| β-strand | 114-118 | 5 | 14 |
| β-strand | 128 | 1 | 15 |
| α-helix | 132-140 | 9 | |
| β-strand | 145-147 | 3 | 14 |
| α-helix | 154-163 | 10 | |
| β-strand | 167-172 | 6 | 16 |
| β-strand | 175-182 | 8 | 16 |
| α-helix | 186-200 | 15 | |
| α-helix | 210-218 | 9 | |
| β-strand | 222-227 | 6 | 14 |
| α-helix | 229-231 | 3 | |
| α-helix | 232-238 | 7 | |
| β-strand | 242-245 | 4 | 14 |
| α-helix | 246-248 | 3 | |
| β-strand | 249 | 1 | 15 |
| β-strand | 250 | 1 | 17 |
| β-strand | 253 | 1 | 17 |
| α-helix | 254-255 | 2 | |
| β-strand | 258-259 | 2 | 18 |
| β-strand | 260-266 | 7 | 10 |
| β-strand | 267 | 1 | 11 |
| α-helix | 273-279 | 7 | |
| α-helix | 280-284 | 5 | |
| α-helix | 287-296 | 10 | |
| β-strand | 301-302 | 2 | 10 |
| β-strand | 304 | 1 | 12 |
| α-helix | 305-310 | 6 | |
| α-helix | 315-326 | 12 | |
| β-strand | 328-329 | 2 | 18 |
| α-helix | 330-331 | 2 | |
| α-helix | 336-351 | 16 | |
| α-helix | 357-396 | 40 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Maltose-binding periplasmic protein, Ataxin-3 chimera | A, B | protein | 441 | Escherichia coli, Homo sapiens | P0AEX9 (AlphaFold model), P54252 (AlphaFold model) |
>4WTH_1 Maltose-binding periplasmic protein, Ataxin-3 chimera (chains A, B) KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDII FWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKD VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKV NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG AVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEA LKDAQTNAAASEELRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGSLG SDQSYQITAGKLGTGRRFTTS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 6 |
The 2.2-Angstrom resolution crystal structure of the carboxy-terminal region of ataxin-3. Zhemkov, V.A., Kulminskaya, A.A., Bezprozvanny, I.B. et al. FEBS Open Bio (2016) 6:168-178. DOI 10.1002/2211-5463.12029 · PubMed
Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.