4WV4: Heterodimer of TAF8/TAF10

Heterodimer of TAF8/TAF10. Determined by X-ray diffraction at 1.91 Å resolution. Released 28 Jan 2015.

Method: X-ray diffraction
Resolution: 1.91 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,474
Mol. weight: 22.17 kDa
Released: 28 Jan 2015

Explore 4WV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WV4 contains 11 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	115-121	7
α-helix	122-124	3
α-helix	132-141	10
α-helix	149-174	26
β-strand	194-195	2	1
α-helix	197-200	4
α-helix	201-207	7

Chain B: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	29-48	20
β-strand	52-53	2	1
α-helix	55-80	26
α-helix	90-99	10
α-helix	104-106	3
α-helix	107-116	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 10	A	protein	102	Homo sapiens	Q12962 (AlphaFold model)
Transcription initiation factor TFIID subunit 8	B	protein	97	Homo sapiens	Q7Z7C8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WV4_1 Transcription initiation factor TFIID subunit 10 (chains A)
GSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDA
LQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVK

Sequence of entity 2 (B), FASTA

>4WV4_2 Transcription initiation factor TFIID subunit 8 (chains B)
MPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHT
ARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT

Primary citation

Cytoplasmic TAF2-TAF8-TAF10 complex provides evidence for nuclear holo-TFIID assembly from preformed submodules. Trowitzsch, S., Viola, C., Scheer, E. et al. Nat Commun (2015) 6:6011-6011. DOI 10.1038/ncomms7011 · PubMed

Other PDB entries of the same protein (UniProt Q12962 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F69 1.3 Å, Ternary complex of SET7/9 bound to AdoHcy and a TAF10 peptide
3M58 1.4 Å, SET7/9 Y245A in complex with TAF10-K189me1 peptide and AdoHcy
3M55 1.55 Å, SET7/9 Y305F in complex with TAF10-K189me1 peptide and AdoHcy
5EG2 1.55 Å, SET7/9 N265A in complex with AdoHcy and TAF10 peptide
4J7F 1.59 Å, SET7/9Y335pAF in complex with TAF10 peptide and AdoHcy
3M54 1.6 Å, SET7/9 Y305F in complex with TAF10 peptide and AdoHcy
4J8O 1.63 Å, SET7/9 in complex with TAF10K189A peptide and AdoHcy
3M56 1.65 Å, SET7/9 Y305F in complex with TAF10-K189me2 peptide and AdoHcy
3M57 1.7 Å, SET7/9 Y245A in complex with TAF10 peptide and AdoHcy
3M59 1.7 Å, SET7/9 Y245A in complex with TAF10-K189me2 peptide and AdoHcy
4J83 1.7 Å, SET7/9 in complex with TAF10K189A peptide and AdoMet
3M5A 1.75 Å, SET7/9 Y245A in complex with TAF10-K189me3 peptide and AdoHcy

Browse structure collections

About this viewer

MolViewer shows 4WV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.