4X20: Tubulin alpha chain
Discovery of cytotoxic Dolastatin 10 analogs with N-terminal modifications. Determined by X-ray diffraction at 3.5 Å resolution. Released 25 Mar 2015.
- Method
- X-ray diffraction
- Resolution
- 3.5 Å
- Organisms
- Ovis aries, Rattus norvegicus
- Chains
- 5
- Atoms
- 14,717
- Mol. weight
- 221.28 kDa
- Ligands
- GTP, GDP, LOC, 3WY
- Released
- 25 Mar 2015
Explore 4X20 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4X20 contains 96 α-helices and 72 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 21 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-9 | 5 | 1 |
| α-helix | 10-27 | 18 | |
| α-helix | 48-51 | 4 | |
| β-strand | 53-55 | 3 | 2 |
| β-strand | 61-63 | 3 | 2 |
| β-strand | 65-69 | 5 | 1 |
| α-helix | 73-76 | 4 | |
| α-helix | 82-84 | 3 | |
| β-strand | 92-94 | 3 | 1 |
| α-helix | 103-104 | 2 | |
| α-helix | 105-109 | 5 | |
| α-helix | 110-126 | 17 | |
| β-strand | 134-139 | 6 | 1 |
| α-helix | 145-160 | 16 | |
| β-strand | 165-172 | 8 | 1 |
| α-helix | 183-193 | 11 | |
| β-strand | 200-205 | 6 | 1 |
| α-helix | 206-215 | 10 | |
| α-helix | 224-243 | 20 | |
| α-helix | 252-258 | 7 | |
| α-helix | 268 | 1 | |
| β-strand | 269-273 | 5 | 3 |
| β-strand | 277 | 1 | 4 |
| α-helix | 284-286 | 3 | |
| α-helix | 288-295 | 8 | |
| α-helix | 298-300 | 3 | |
| β-strand | 301 | 1 | 3 |
| β-strand | 312 | 1 | 5 |
| β-strand | 316-317 | 2 | 3 |
| β-strand | 318-321 | 4 | 6 |
| α-helix | 325-338 | 14 | |
| β-strand | 349-356 | 8 | 6 |
| β-strand | 368 | 1 | 4 |
| β-strand | 373-374 | 2 | 6 |
| β-strand | 375-379 | 5 | 3 |
| β-strand | 381 | 1 | 5 |
| α-helix | 382-384 | 3 | |
| α-helix | 385-400 | 16 | |
| α-helix | 405-410 | 6 | |
| α-helix | 416-435 | 20 | |
Chain B: 24 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-9 | 6 | 7 |
| α-helix | 10-27 | 18 | |
| β-strand | 30 | 1 | 8 |
| β-strand | 36 | 1 | 8 |
| α-helix | 42-47 | 4 | |
| β-strand | 53-55 | 3 | 9 |
| β-strand | 61-63 | 3 | 9 |
| β-strand | 65-69 | 5 | 7 |
| α-helix | 73-80 | 8 | |
| α-helix | 82-84 | 3 | |
| α-helix | 89-91 | 3 | |
| β-strand | 92-94 | 3 | 7 |
| α-helix | 103-104 | 2 | |
| α-helix | 105-109 | 5 | |
| α-helix | 110-127 | 18 | |
| β-strand | 134-140 | 7 | 7 |
| α-helix | 145-150 | 6 | |
| α-helix | 151-160 | 10 | |
| β-strand | 165-172 | 8 | 7 |
| β-strand | 174 | 1 | 10 |
| β-strand | 177 | 1 | 10 |
| α-helix | 183-197 | 15 | |
| β-strand | 200-205 | 6 | 7 |
| α-helix | 206-211 | 6 | |
| α-helix | 212-216 | 5 | |
| α-helix | 224-238 | 15 | |
| α-helix | 240-243 | 4 | |
| α-helix | 252-259 | 8 | |
| β-strand | 267-268 | 2 | 7 |
| β-strand | 271 | 1 | 11 |
| α-helix | 288-296 | 9 | |
| α-helix | 298-300 | 3 | |
| β-strand | 301 | 1 | 11 |
| β-strand | 312-320 | 9 | 11 |
| α-helix | 325-338 | 14 | |
| α-helix | 340-342 | 3 | |
| β-strand | 343 | 1 | 11 |
| β-strand | 351-355 | 5 | 11 |
| β-strand | 374-381 | 8 | 11 |
| α-helix | 382-384 | 3 | |
| α-helix | 385-400 | 16 | |
| α-helix | 406-409 | 4 | |
| α-helix | 415-437 | 23 | |
Chain C: 25 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-9 | 7 | 12 |
| α-helix | 12-27 | 16 | |
| α-helix | 48-51 | 4 | |
| β-strand | 53-55 | 3 | 13 |
| β-strand | 61-63 | 3 | 13 |
| β-strand | 65-69 | 5 | 12 |
| α-helix | 73-80 | 8 | |
| α-helix | 84-86 | 3 | |
| β-strand | 92-94 | 3 | 12 |
| α-helix | 103-104 | 2 | |
| α-helix | 105-109 | 5 | |
| α-helix | 112-127 | 16 | |
| β-strand | 132-140 | 9 | 12 |
| α-helix | 144 | 1 | |
| α-helix | 145-149 | 5 | |
| α-helix | 150-160 | 11 | |
| β-strand | 165-171 | 7 | 12 |
| α-helix | 183-195 | 13 | |
| β-strand | 200-203 | 4 | 12 |
| α-helix | 206-212 | 7 | |
| α-helix | 213-217 | 5 | |
| α-helix | 224-243 | 20 | |
| α-helix | 254-259 | 6 | |
| α-helix | 268 | 1 | |
| β-strand | 269-273 | 5 | 14 |
| β-strand | 277 | 1 | 15 |
| α-helix | 288-294 | 7 | |
| β-strand | 312-320 | 9 | 14 |
| α-helix | 325-335 | 11 | |
| α-helix | 342 | 1 | |
| β-strand | 343 | 1 | 14 |
| α-helix | 344 | 1 | |
| β-strand | 352-356 | 5 | 14 |
| α-helix | 359-361 | 3 | |
| β-strand | 368 | 1 | 15 |
| β-strand | 374-381 | 8 | 14 |
| α-helix | 382-384 | 3 | |
| α-helix | 385-401 | 17 | |
| α-helix | 405-409 | 5 | |
| α-helix | 415-435 | 21 | |
Chain D: 25 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-9 | 6 | 16 |
| α-helix | 10-28 | 19 | |
| β-strand | 30 | 1 | 17 |
| β-strand | 36 | 1 | 17 |
| β-strand | 53-55 | 3 | 18 |
| α-helix | 57-59 | 3 | |
| β-strand | 61-63 | 3 | 18 |
| β-strand | 65-69 | 5 | 16 |
| α-helix | 72-79 | 8 | |
| α-helix | 84-86 | 3 | |
| α-helix | 89-91 | 3 | |
| β-strand | 93-94 | 2 | 16 |
| α-helix | 103-107 | 5 | |
| α-helix | 109-127 | 19 | |
| β-strand | 134-140 | 7 | 16 |
| α-helix | 145-149 | 5 | |
| α-helix | 150-160 | 11 | |
| β-strand | 165-172 | 8 | 16 |
| α-helix | 183-197 | 15 | |
| β-strand | 200-205 | 6 | 16 |
| α-helix | 206-211 | 6 | |
| α-helix | 212-216 | 5 | |
| α-helix | 224-238 | 15 | |
| α-helix | 240-243 | 4 | |
| α-helix | 252-259 | 8 | |
| β-strand | 267-268 | 2 | 16 |
| β-strand | 271-273 | 3 | 19 |
| α-helix | 285-287 | 3 | |
| α-helix | 288-293 | 6 | |
| α-helix | 298-300 | 3 | |
| β-strand | 301 | 1 | 19 |
| β-strand | 312-320 | 9 | 19 |
| α-helix | 325-338 | 14 | |
| α-helix | 340-342 | 3 | |
| β-strand | 343 | 1 | 19 |
| β-strand | 351-356 | 6 | 19 |
| α-helix | 359-360 | 2 | |
| β-strand | 374-381 | 8 | 19 |
| α-helix | 382-384 | 3 | |
| α-helix | 385-400 | 16 | |
| α-helix | 406-409 | 4 | |
| α-helix | 416-437 | 22 | |
Chain E: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 12-14 | 3 | 6 |
| β-strand | 17-25 | 9 | 6 |
| α-helix | 48-140 | 93 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tubulin alpha chain | A, C | protein | 451 | Ovis aries | D0VWZ0 (AlphaFold model) |
| Tubulin beta chain | B, D | protein | 445 | Ovis aries | D0VWY9 (AlphaFold model) |
| Stathmin-4 | E | protein | 142 | Rattus norvegicus | P63043 (AlphaFold model) |
Sequence of entity 1 (A, C), FASTA
>4X20_1 Tubulin alpha chain (chains A, C)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Sequence of entity 2 (B, D), FASTA
>4X20_2 Tubulin beta chain (chains B, D)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA
Sequence of entity 3 (E), FASTA
>4X20_3 Stathmin-4 (chains E)
ADMEVIELNKATSGQSWEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKY
QEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERL
QEKDKHAEEVRKNKELKEEASR
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 2 |
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 2 |
| LOC | N-[(7S)-1,2,3,10-tetramethoxy-9-oxo-6,7-dihydro-5H-benzo[d]heptalen-7-yl]ethana… | C22 H25 N O6 | 2 |
| 3WY | 2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenyle… | C39 H63 N5 O8 | 2 |
| MG | Magnesium ion | Mg | 2 |
Primary citation
Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications. Maderna, A., Doroski, M., Subramanyam, C. et al. J Med Chem (2014) 57:10527-10543. DOI 10.1021/jm501649k · PubMed
Other PDB entries of the same protein (UniProt D0VWZ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5EYP 1.9 Å, Tubulin-darpin complex
- 3RYC 2.1 Å, Tubulin: RB3 stathmin-like domain complex
- 9F07 2.21 Å, Tubulin:stathmin:darpin:tau MTBR3 complex
- 4DRX 2.22 Å, GTP-Tubulin in complex with a DARPIN
- 6TDE 2.29 Å, Tubulin-inhibitor complex
- 3RYI 2.4 Å, GDP-Tubulin: rb3 stathmin-like domain complex
- 5KX5 2.5 Å, Crystal structure of tubulin-stathmin-TTL-Compound 11 complex
- 3RYF 2.52 Å, GTP-Tubulin: RB3 Stathmin-like domain complex
- 4F6R 2.64 Å, Tubulin:Stathmin-like domain complex
- 6GVN 2.69 Å, Tubulin:TM-3 DARPin complex
- 3UT5 2.73 Å, Tubulin-Colchicine-Ustiloxin: Stathmin-like domain complex
- 6H9B 2.75 Å, 1,1-Diheterocyclic Ethylenes Derived from Quinaldine and Carbazole as New Tubulin…
Browse structure collections
About this viewer
MolViewer shows 4X20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.