Structural view and substrate specificity of papain-like protease from Avian Infectious Bronchitis Virus. Determined by X-ray diffraction at 2.15 Å resolution. Released 28 Jan 2015.
Explore 4X2Z in 3D Show helices and sheets RCSB PDB PDBe
4X2Z contains 14 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 17-21 | 5 | 1 |
| α-helix | 27-30 | 4 | |
| β-strand | 34 | 1 | 1 |
| α-helix | 43-45 | 3 | |
| α-helix | 46-47 | 2 | |
| β-strand | 51-53 | 3 | 1 |
| α-helix | 59-65 | 7 | |
| α-helix | 69-78 | 10 | |
| β-strand | 85-88 | 4 | 2 |
| β-strand | 91-94 | 4 | 2 |
| α-helix | 95-96 | 2 | |
| α-helix | 101-112 | 12 | |
| β-strand | 117 | 1 | 3 |
| α-helix | 120-129 | 10 | |
| α-helix | 134-143 | 10 | |
| α-helix | 154-162 | 9 | |
| β-strand | 165 | 1 | 3 |
| β-strand | 173-180 | 8 | 4 |
| β-strand | 183-190 | 8 | 4 |
| α-helix | 191-195 | 5 | |
| β-strand | 196-199 | 4 | 4 |
| α-helix | 204-208 | 5 | |
| β-strand | 209-213 | 5 | 4 |
| β-strand | 220-237 | 18 | 4 |
| β-strand | 242-245 | 4 | 4 |
| α-helix | 246-247 | 2 | |
| β-strand | 252-258 | 7 | 4 |
| β-strand | 263-269 | 7 | 4 |
| β-strand | 272-274 | 3 | 4 |
| α-helix | 281-283 | 3 | |
| β-strand | 286-300 | 15 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nonstructural protein 3 | A | protein | 322 | Avian infectious bronchitis virus | P0C6Y1 (AlphaFold model) |
>4X2Z_1 Nonstructural protein 3 (chains A) GPLGSTCKQKTIYLTEDGVKYRSIVLKPGDSLGQFGQVYAKNKIVFTADDVEDKEILYVP TTDKSILEYYGLDAQKYVIYLQTLAQKWNVQYRDNFLILEWRDGNCWISSAIVLLQAAKI RFKGFLTEAWAKLLGGDPTDFVAWCYASCTAKVGDFSDANWLLANLAEHFDADYTNAFLK KRVSCNCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGANNTDEVIEASLPYLLL FATDGPATVDCDEDAVGTVVFVGSTNSGHCYTQAAGQAFDNLAKDRKFGKKSPYITAMYT RFAFKNETSLPVAKQLERPHRD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Structural View and Substrate Specificity of Papain-like Protease from Avian Infectious Bronchitis Virus. Kong, L., Shaw, N., Yan, L. et al. J Biol Chem (2015) 290:7160-7168. DOI 10.1074/jbc.M114.628636 · PubMed
Other PDB entries of the same protein (UniProt P0C6Y1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4X2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.