4X3U: Chromobox protein homolog 7

Crystal structure of chromobox homolog 7 (CBX7) chromodomain with Suramin. Determined by X-ray diffraction at 1.63 Å resolution. Released 4 Mar 2015.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,267
Mol. weight: 18.06 kDa
Ligands: SVR
Released: 4 Mar 2015

Explore 4X3U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X3U contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	13-22	10	1
β-strand	25-32	8	1
α-helix	37-39	3
β-strand	41-43	3	1
α-helix	45-47	3
α-helix	52-62	11

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	13-22	10	2
β-strand	25-32	8	2
α-helix	37-39	3
β-strand	41-44	4	2
α-helix	45-47	3
α-helix	51-61	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 7	A, B	protein	64	Mus musculus	Q8VDS3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4X3U_1 Chromobox protein homolog 7 (chains A, B)
GSHMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
RDRA

Ligands and cofactors

ID	Name	Formula	Copies
SVR	8,8'-[carbonylbis[imino-3,1-PHENYLENECARBONYLIMINO(4-methyl-3,1-phenylene)carbo…	C51 H40 N6 O23 S6	2

Primary citation

Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain. Ren, C., Morohashi, K., Plotnikov, A.N. et al. Chem Biol (2015) 22:161-168. DOI 10.1016/j.chembiol.2014.11.021 · PubMed

Other PDB entries of the same protein (UniProt Q8VDS3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4X3K 1.45 Å, Crystal structure of chromobox homolog 7 (CBX7) chromodomain with H3K27me3 peptide
4X3S 1.6 Å, Crystal structure of chromobox homology 7 (CBX7) with SETDB1-1170me3 Peptide
4X3T 2.14 Å, Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS37452
5EJW 2.6 Å, Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS351
2KVM Solution structure of the CBX7 chromodomain in complex with a H3K27me2 peptide

Browse structure collections

About this viewer

MolViewer shows 4X3U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.