4XHJ: GHgL of Varicella-zoster virus

gHgL of Varicella-zoster virus in complex with human neutralizing antibodies. Determined by X-ray diffraction at 3.16 Å resolution. Released 13 May 2015.

Method: X-ray diffraction
Resolution: 3.16 Å
Organisms: Human herpesvirus 3 strain Oka vaccine, Homo sapiens
Chains: 8
Atoms: 19,505
Mol. weight: 327.62 kDa
Ligands: NAG
Released: 13 May 2015

Explore 4XHJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XHJ contains 97 α-helices and 158 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	37-43	7	1
β-strand	49-54	6	1
α-helix	63-66	4
α-helix	69-71	3
β-strand	75-81	7	1
β-strand	90-96	7	1
α-helix	99-101	3
β-strand	127-128	2	2
α-helix	138-142	5
β-strand	145	1	3
β-strand	149	1	3
α-helix	156-158	3
β-strand	160	1	4
α-helix	161-164	4
α-helix	181-186	6
β-strand	192	1	5
α-helix	201-204	4
β-strand	208-210	3	5
α-helix	212-215	4
β-strand	219-223	5	2
α-helix	226-228	3
β-strand	230	1	6
β-strand	233-244	12	2
β-strand	248-255	8	2
β-strand	258-265	8	2
β-strand	271-277	7	2
β-strand	284	1	6
α-helix	295-296	2
β-strand	298	1	4
β-strand	305-310	6	2
α-helix	323-327	5
α-helix	329-332	4
α-helix	336-351	16
α-helix	361-385	25
β-strand	387-389	3	5
α-helix	390-406	17
α-helix	407-412	6
α-helix	416-418	3
β-strand	420-425	6	2
α-helix	430-441	12
α-helix	455-467	13
α-helix	475-494	20
α-helix	500-513	14
α-helix	525-539	15
α-helix	542-557	16
α-helix	568-570	3
α-helix	574-576	3
β-strand	580	1	7
α-helix	582-584	3
α-helix	586-595	10
α-helix	596-598	3
α-helix	600-607	8
α-helix	612-628	17
α-helix	634-640	7
α-helix	642-645	4
α-helix	651-654	4
β-strand	657-662	6	7
β-strand	667-672	6	7
β-strand	679-683	5	7
β-strand	694-699	6	7
β-strand	705-707	3	7
β-strand	711-714	4	8
β-strand	730-735	6	8
β-strand	740-742	3	8
β-strand	745	1	8
α-helix	749-755	7
α-helix	764-766	3
β-strand	775-780	6	8
β-strand	786-790	5	8

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	35-37	3	1
α-helix	42-46	5
α-helix	50-53	4
β-strand	71-77	7	1
β-strand	84-89	6	1
β-strand	94-98	5	1
α-helix	100-110	11
α-helix	119-127	9
α-helix	136-139	4

Chain C: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	9
β-strand	10-14	5	10
β-strand	19-25	7	9
β-strand	33-38	6	10
β-strand	45-48	4	10
α-helix	53	1
β-strand	54	1	10
α-helix	55	1
β-strand	62-67	6	9
β-strand	70-75	6	9
α-helix	80-82	3
β-strand	84-90	7	10
β-strand	98	1	10
β-strand	102-107	6	10
β-strand	112	1	11
β-strand	115-118	4	12
α-helix	123-126	4
β-strand	130-140	11	12
β-strand	141	1	11
β-strand	146-148	3	13
α-helix	152-153	2
β-strand	162-164	3	12
α-helix	165-168	4
β-strand	174-183	10	12
β-strand	193-198	6	13
β-strand	207-210	4	13

Chain D: 3 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	14
β-strand	10-11	2	15
β-strand	17-23	7	14
α-helix	29-31	3
β-strand	34-39	6	15
β-strand	46-51	6	15
β-strand	58-60	3	15
β-strand	68-73	6	14
β-strand	78-84	7	14
β-strand	91-98	8	15
β-strand	107-110	4	15
β-strand	114-117	4	15
α-helix	122-123	2
β-strand	124	1	16
β-strand	127-128	2	17
β-strand	147-152	6	17
β-strand	153	1	16
β-strand	158-161	4	18
β-strand	171-172	2	17
α-helix	173-175	3
β-strand	176-177	2	17
β-strand	183-188	6	17
β-strand	202-207	6	18
β-strand	212-217	6	18

Chain E: 34 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	37-43	7	19
β-strand	49-54	6	19
α-helix	62-65	4
β-strand	75-81	7	19
β-strand	90-96	7	19
α-helix	99-101	3
β-strand	127-128	2	20
α-helix	138-142	5
β-strand	145	1	21
β-strand	149	1	21
α-helix	156-158	3
β-strand	160	1	22
α-helix	161-164	4
α-helix	181-186	6
β-strand	192	1	23
α-helix	201-204	4
β-strand	208-210	3	23
α-helix	213-216	4
β-strand	219-223	5	20
α-helix	226-228	3
β-strand	230	1	24
β-strand	233-244	12	20
β-strand	248-255	8	20
β-strand	258-265	8	20
β-strand	271-277	7	20
β-strand	284	1	24
α-helix	295-296	2
β-strand	298	1	22
β-strand	305-310	6	20
α-helix	324-327	4
α-helix	329-332	4
α-helix	336-351	16
α-helix	361-385	25
β-strand	387-389	3	23
α-helix	390-406	17
α-helix	407-412	6
α-helix	416-418	3
β-strand	420-425	6	20
α-helix	430-441	12
α-helix	455-467	13
α-helix	475-494	20
α-helix	500-513	14
α-helix	527-539	13
α-helix	542-557	16
α-helix	568-571	4
α-helix	574-576	3
β-strand	580	1	25
α-helix	582-584	3
α-helix	586-595	10
α-helix	596-598	3
α-helix	600-607	8
α-helix	612-628	17
α-helix	634-640	7
α-helix	642-645	4
β-strand	657-662	6	25
β-strand	667-672	6	25
β-strand	679-684	6	25
β-strand	693-699	7	25
β-strand	705-707	3	25
β-strand	711-712	2	26
β-strand	730-735	6	26
β-strand	740-742	3	26
β-strand	745	1	26
α-helix	749-755	7
α-helix	764-766	3
β-strand	775-780	6	26
β-strand	786-788	3	26

Chain F: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	35-37	3	19
α-helix	42-46	5
α-helix	50-53	4
β-strand	73-77	5	19
β-strand	84-88	5	19
β-strand	94-98	5	19
α-helix	100-110	11
α-helix	119-127	9
α-helix	136-139	4

Chain G: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	27
β-strand	10-14	5	28
β-strand	19-25	7	27
β-strand	33-38	6	28
β-strand	45-48	4	28
α-helix	53	1
β-strand	54	1	28
α-helix	55	1
β-strand	62-67	6	27
β-strand	70-75	6	27
α-helix	80-82	3
β-strand	84-90	7	28
β-strand	98	1	28
β-strand	102-107	6	28
β-strand	115-119	5	29
α-helix	123-126	4
β-strand	132-140	9	29
β-strand	147-149	3	30
β-strand	164	1	29
α-helix	165-168	4
β-strand	174-181	8	29
β-strand	193-197	5	30
β-strand	207-210	4	30

Chain H: 3 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	31
β-strand	10-12	3	32
β-strand	17-23	7	31
α-helix	29-31	3
β-strand	34-39	6	32
β-strand	45-51	7	32
β-strand	58-60	3	32
β-strand	68-73	6	31
β-strand	78-84	7	31
β-strand	91-98	8	32
β-strand	107-110	4	32
β-strand	114-118	5	32
α-helix	122-123	2
β-strand	124	1	33
β-strand	127-128	2	34
β-strand	148	1	35
β-strand	149-150	2	34
β-strand	152	1	36
β-strand	153	1	33
β-strand	157-161	5	37
β-strand	171-172	2	38
α-helix	173-175	3
β-strand	176-177	2	36
β-strand	183-184	2	36
β-strand	186	1	35
β-strand	187-188	2	38
β-strand	202-207	6	37
β-strand	212-217	6	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope glycoprotein H	A, E	protein	833	Human herpesvirus 3 strain Oka vaccine	Q775J3
Envelope glycoprotein L	B, F	protein	138	Human herpesvirus 3 strain Oka vaccine	Q9J3N1
Fab-RC light chain	C, G	protein	215	Homo sapiens
Fab-RC heavy chain	D, H	protein	282	Homo sapiens

Sequence of entity 1 (A, E), FASTA

>4XHJ_1 Envelope glycoprotein H (chains A, E)
MFALVLAVVILPLWTTANKSYVTPTPATRSIGHMSALLREYSDRNMSLKLEAFYPTGFDE
ELIKSLHWGNDRKHVFLVIVKVNPTTHEGDVGLVIFPKYLLSPYHFKAEHRAPFPAGRFG
FLSHPVTPDVSFFDSSFAPYLTTQHLVAFTTFPPNPLVWHLERAETAATAERPFGVSLLP
ARPTVPKNTILEHKAHFATWDALARHTFFSAEAIITNSTLRIHVPLFGSVWPIRYWATGS
VLLTSDSGRVEVNIGVGFMSSLISLSSGLPIELIVVPHTVKLNAVTSDTTWFQLNPPGPD
PGPSYRVYLLGRGLDMNFSKHATVDICAYPEESLDYRYHLSMAHTEALRMTTKADQHDIN
EESYYHIAARIATSIFALSEMGRTTEYFLLDEIVDVQYQLKFLNYILMRIGAGAHPNTIS
GTSDLIFADPSQLHDELSLLFGQVKPANVDYFISYDEARDQLKTAYALSRGQDHVNALSL
ARRVIMSIYKGLLVKQNLNATERQALFFASMILLNFREGLENSSRVLDGRTTLLLMTSMC
TAAHATQAALNIQEGLAYLNPSKHMFTIPNVYSPCMGSLRTDLTEEIHVMNLLSAIPTRP
GLNEVLHTQLDESEIFDAAFKTMMIFTTWTAKDLHILHTHVPEVFTCQDAAARNGEYVLI
LPAVQGHSYVITRNKPQRGLVYSLADVDVYNPISVVYLSKDTCVSEHGVIETVALPHPDN
LKECLYCGSVFLRYLTTGAIMDIIIIDSKDTERQLAAMGNSTIPPFNPDMHGDDSKAVLL
FPNGTVVTLLGFERRGSENLYFQGSWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Sequence of entity 2 (B, F), FASTA

>4XHJ_2 Envelope glycoprotein L (chains B, F)
LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPV
PEVILWFKDKQMAYWTNPYVTLKGLTQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNI
PENGCVWGADRLFQRVCQ

Sequence of entity 3 (C, G), FASTA

>4XHJ_3 Fab-RC light chain (chains C, G)
DIQMTQSPSFLSASVGDRVTITCRASQGLDNFLAWYQQKPGKAPKLLIYAASTLQRGVPS
RFGGSGSGTEFTLTISSLQPEDFATYYCQQLNSYSLTFGPGTKVEIKRRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (D, H), FASTA

>4XHJ_4 Fab-RC heavy chain (chains D, H)
MEFGLSWVFLVAILEGVHCQVQLVQSGAEMKKPGASVKVSCKASGYTFIGYHLHWVRQAP
GQGLEWMGWINPNSGETNYAQKFQDWVTMTRDTSINTAYMELRLRSDDTAVYYCARGGMT
MVRGVMMDWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
SCDKGSENLYFQGSWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL. Xing, Y., Oliver, S.L., Nguyen, T. et al. Proc Natl Acad Sci U S A (2015) 112:6056-6061. DOI 10.1073/pnas.1501176112 · PubMed

Other PDB entries of the same protein (UniProt Q775J3), best resolution first:

4XI5 3.9 Å, gHgL of varicella-zoster virus in complex with human neutralizing antibodies

Browse structure collections

About this viewer

MolViewer shows 4XHJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.