KIF2C short Loop2 construct. Determined by X-ray diffraction at 2.59 Å resolution. Released 17 Jun 2015.
Explore 4Y05 in 3D Show helices and sheets RCSB PDB PDBe
4Y05 contains 18 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 232-242 | 11 | |
| β-strand | 246 | 1 | 1 |
| α-helix | 253-254 | 2 | |
| β-strand | 259-265 | 7 | 2 |
| α-helix | 266-269 | 4 | |
| α-helix | 270-274 | 5 | |
| β-strand | 279 | 1 | 3 |
| β-strand | 281-282 | 2 | 4 |
| β-strand | 285 | 1 | 1 |
| β-strand | 288-297 | 7 | 4 |
| β-strand | 304-310 | 7 | 4 |
| β-strand | 313-315 | 3 | 2 |
| α-helix | 321-327 | 7 | |
| α-helix | 330-337 | 8 | |
| β-strand | 341-347 | 7 | 2 |
| α-helix | 354-358 | 5 | |
| α-helix | 373-385 | 13 | |
| α-helix | 388-391 | 4 | |
| β-strand | 396-405 | 10 | 2 |
| β-strand | 408-411 | 4 | 2 |
| β-strand | 417-419 | 3 | 2 |
| β-strand | 420-423 | 4 | 5 |
| β-strand | 429-432 | 4 | 5 |
| β-strand | 437-439 | 3 | 2 |
| α-helix | 442-455 | 14 | |
| α-helix | 467-469 | 3 | |
| β-strand | 471-479 | 9 | 2 |
| β-strand | 484-492 | 9 | 2 |
| α-helix | 493-495 | 3 | |
| α-helix | 514-531 | 18 | |
| α-helix | 539-541 | 3 | |
| α-helix | 543-547 | 5 | |
| α-helix | 549-552 | 4 | |
| β-strand | 557-565 | 9 | 2 |
| β-strand | 568 | 1 | 3 |
| α-helix | 569-571 | 3 | |
| α-helix | 572-585 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kinesin-like protein KIF2C | A | protein | 387 | Homo sapiens | Q99661 (AlphaFold model) |
>4Y05_1 Kinesin-like protein KIF2C (chains A) MGRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQEL AKKEIDVISIPSKCLLLVHEKVDYLENQAFCFDFAFDETASNEVVYRFTAAPLVQTIFEG GKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASADVFLLKNQPCYRKLGLEVYV TFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSG QTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKS LLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTL RYADRVKELSPHSGPSGEQLEHHHHHH
Water and common crystallization additives (SO4) are not listed.
New Insights into the Coupling between Microtubule Depolymerization and ATP Hydrolysis by Kinesin-13 Protein Kif2C. Wang, W., Shen, T., Guerois, R. et al. J Biol Chem (2015) 290:18721-18731. DOI 10.1074/jbc.M115.646919 · PubMed
Other PDB entries of the same protein (UniProt Q99661 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Y05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.