Trypsin in complex with with BPTI mutant AMINOBUTYRIC ACID. Determined by X-ray diffraction at 1.37 Å resolution. Released 24 Jun 2015.
Explore 4Y0Z in 3D Show helices and sheets RCSB PDB PDBe
4Y0Z contains 10 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| β-strand | 30-34 | 5 | 3 |
| β-strand | 40-48 | 9 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 64-67 | 4 | 3 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 104-108 | 5 | 3 |
| β-strand | 115 | 1 | 4 |
| β-strand | 118 | 1 | 4 |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-124 | 2 | |
| α-helix | 128-130 | 3 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 191 | 1 | 1 |
| β-strand | 200-203 | 4 | 2 |
| β-strand | 206-217 | 8 | 2 |
| β-strand | 228-232 | 5 | 2 |
| α-helix | 233-236 | 4 | |
| α-helix | 237-245 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 8-9 | 2 | |
| β-strand | 14 | 1 | 2 |
| β-strand | 18-24 | 7 | 5 |
| β-strand | 29-35 | 7 | 5 |
| β-strand | 45 | 1 | 5 |
| α-helix | 48-55 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cationic trypsin | E | protein | 223 | Bos taurus | P00760 (AlphaFold model) |
| Pancreatic trypsin inhibitor | I | protein | 58 | Bos taurus | P00974 (AlphaFold model) |
>4Y0Z_1 Cationic trypsin (chains E) IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG WGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGP VVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
>4Y0Z_2 Pancreatic trypsin inhibitor (chains I) RPDFCLEPPYTGPCAARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (SO4, GOL) are not listed.
Fluorine teams up with water to restore inhibitor activity to mutant BPTI. Ye, S., Loll, B., Berger, A.A. et al. Chem Sci (2015) 6:5246-5254. DOI 10.1039/c4sc03227f · PubMed
Other PDB entries of the same protein (UniProt P00760 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Y0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.