Pyridopyrimidinone Derivatives as Potent and Selective c-Jun N-Terminal Kinase (JNK) inhibitors. Determined by X-ray diffraction at 2.04 Å resolution. Released 6 May 2015.
Explore 4Y46 in 3D Show helices and sheets RCSB PDB PDBe
4Y46 contains 19 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 48-53 | 6 | 1 |
| β-strand | 56-61 | 6 | 1 |
| β-strand | 64-72 | 9 | 2 |
| β-strand | 76-83 | 8 | 2 |
| β-strand | 88-96 | 9 | 2 |
| α-helix | 98-100 | 3 | |
| α-helix | 102-117 | 16 | |
| β-strand | 123 | 1 | 3 |
| β-strand | 126-130 | 5 | 2 |
| β-strand | 141-147 | 7 | 2 |
| β-strand | 151-152 | 2 | 3 |
| α-helix | 153-157 | 5 | |
| α-helix | 163-182 | 20 | |
| α-helix | 192-194 | 3 | |
| β-strand | 195-197 | 3 | 3 |
| β-strand | 203-205 | 3 | 3 |
| α-helix | 232-236 | 5 | |
| α-helix | 244-258 | 15 | |
| α-helix | 268-279 | 12 | |
| α-helix | 281-283 | 3 | |
| α-helix | 284-287 | 4 | |
| α-helix | 292-300 | 9 | |
| α-helix | 302-303 | 2 | |
| α-helix | 309-312 | 4 | |
| α-helix | 315-317 | 3 | |
| α-helix | 323-339 | 17 | |
| α-helix | 348-349 | 2 | |
| α-helix | 350-355 | 6 | |
| α-helix | 360-362 | 3 | |
| α-helix | 387-398 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitogen-activated protein kinase 10 | A | protein | 366 | Homo sapiens | P53779 (AlphaFold model) |
>4Y46_1 Mitogen-activated protein kinase 10 (chains A) MAMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLS RPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQV IQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGT SFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVI EQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLL SKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYK EVMNSE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4F2 | 1-{trans-4-[(8-cyclopentyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-2-yl)amino]c… | C22 H32 N6 O2 | 1 |
Pyridopyrimidinone Derivatives as Potent and Selective c-Jun N-Terminal Kinase (JNK) Inhibitors. Zheng, K., Park, C.M., Iqbal, S. et al. ACS Med Chem Lett (2015) 6:413-418. DOI 10.1021/ml500474d · PubMed
Other PDB entries of the same protein (UniProt P53779 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Y46 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.