4Y4R: Ribosomal oxygenase NO66 dimer mutant

Crystal structure of ribosomal oxygenase NO66 dimer mutant. Determined by X-ray diffraction at 3.3 Å resolution. Released 7 Oct 2015.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,082
Mol. weight: 103.31 kDa
Ligands: NI
Released: 7 Oct 2015

Explore 4Y4R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Y4R contains 45 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	184-192	9
α-helix	198-210	13
α-helix	215-217	3
α-helix	218-222	5
β-strand	228-230	3	1
α-helix	244-253	10
β-strand	258	1	1
β-strand	262-268	7	1
β-strand	271-274	4	1
α-helix	283-291	9
α-helix	294	1
β-strand	295-298	4	1
α-helix	301-304	4
α-helix	306-319	14
β-strand	324-330	7	1
β-strand	340-341	2	2
β-strand	345-353	9	1
β-strand	355-360	6	2
α-helix	365-367	3
α-helix	373-377	5
α-helix	379-381	3
β-strand	387-391	5	2
β-strand	396-399	4	1
β-strand	404-408	5	2
β-strand	415-422	8	1
β-strand	427	1	3
α-helix	428-446	19
α-helix	448-450	3
β-strand	453	1	4
α-helix	458-460	3
α-helix	465-467	3
α-helix	474-489	16
α-helix	494-508	15
α-helix	510-512	3
α-helix	516-521	6
β-strand	522	1	5
β-strand	535-538	4	5
β-strand	544-548	5	6
β-strand	553-557	5	6
α-helix	569-571	3
β-strand	572-574	3	6
α-helix	580-588	9
β-strand	594-595	2	5
α-helix	596-598	3
α-helix	604-616	13
β-strand	620-622	3	5

Chain B: 21 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	184-193	10
α-helix	198-210	13
α-helix	215-221	7
β-strand	228-230	3	7
α-helix	244-253	10
β-strand	257	1	8
β-strand	258	1	9
β-strand	262	1	9
β-strand	263-268	6	7
β-strand	271-274	4	7
β-strand	280	1	8
α-helix	283-291	9
β-strand	295-299	5	7
α-helix	306-319	14
β-strand	324-330	7	7
β-strand	335	1	7
β-strand	340	1	10
β-strand	345-353	9	7
β-strand	355-359	5	10
α-helix	365-367	3
α-helix	374-377	4
β-strand	387-391	5	10
β-strand	396-399	4	7
β-strand	405-408	4	10
β-strand	415-422	8	7
β-strand	427	1	4
α-helix	428-446	19
α-helix	449-451	3
β-strand	453	1	3
α-helix	454-455	2
α-helix	458-460	3
α-helix	464-466	3
α-helix	474-491	18
α-helix	494-508	15
α-helix	510-515	6
α-helix	516-521	6
β-strand	538	1	11
β-strand	544-547	4	12
β-strand	554-557	4	12
α-helix	569-570	2
β-strand	572-574	3	12
α-helix	577-588	12
α-helix	596-598	3
α-helix	604-616	13
β-strand	620	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66	A, B	protein	454	Homo sapiens	Q9H6W3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4Y4R_1 Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 (chains A, B)
GGEPAWDSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRRLWEREAVLVRRQDH
TYYQGLFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCS
LRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRK
LWRVYRPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHS
LHLTLSTYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRT
AFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGGGGQLTTETE
VHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLGSYPEFVR
VGDLPCDSVEDQLSLATTLYDKGLLLTKMPLALN

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	2

Water and common crystallization additives (ACT) are not listed.

Primary citation

Structure of the JmjC domain-containing protein NO66 complexed with ribosomal protein Rpl8. Wang, C., Zhang, Q., Hang, T. et al. Acta Crystallogr D Biol Crystallogr (2015) 71:1955-1964. DOI 10.1107/S1399004715012948 · PubMed

Other PDB entries of the same protein (UniProt Q9H6W3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CCJ 2.15 Å, 60S ribosomal protein L8 histidine hydroxylase (NO66) in apo form
4CCK 2.15 Å, 60S ribosomal protein L8 histidine hydroxylase (NO66) in complex with Mn(II) and…
4Y3O 2.2 Å, Crystal structure of Ribosomal oxygenase NO66 in complex with substrate Rpl8 peptide and…
4CCN 2.23 Å, 60S ribosomal protein L8 histidine hydroxylase (NO66 L299C/C300S) in complex with…
4E4H 2.28 Å, Crystal structure of Histone Demethylase NO66
4CCO 2.3 Å, 60S ribosomal protein L8 histidine hydroxylase (NO66 S373C) in complex with Mn(II),…
4DIQ 2.4 Å, Crystal Structure of human NO66
4CCM 2.51 Å, 60S ribosomal protein L8 histidine hydroxylase (NO66) in complex with Mn(II),…
4Y33 2.7 Å, Crystal of NO66 in complex with Ni(II)and N-oxalylglycine (NOG)

Browse structure collections

About this viewer

MolViewer shows 4Y4R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.