The crystal structure of the Y57H mutant of human GlnRS. Determined by X-ray diffraction at 3.3 Å resolution. Released 17 Feb 2016.
Explore 4YE8 in 3D Show helices and sheets RCSB PDB PDBe
4YE8 contains 32 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-11 | 6 | |
| α-helix | 17-25 | 9 | |
| α-helix | 29-38 | 10 | |
| α-helix | 50-62 | 13 | |
| α-helix | 66-68 | 3 | |
| α-helix | 69-77 | 9 | |
| α-helix | 84-95 | 12 | |
| α-helix | 104-109 | 6 | |
| α-helix | 119-131 | 13 | |
| α-helix | 134-140 | 7 | |
| α-helix | 141-143 | 3 | |
| α-helix | 146-154 | 9 | |
| α-helix | 162-177 | 16 | |
| α-helix | 226-228 | 3 | |
| α-helix | 231-233 | 3 | |
| α-helix | 237-239 | 3 | |
| α-helix | 249-260 | 12 | |
| β-strand | 265-268 | 4 | 1 |
| β-strand | 277 | 1 | 2 |
| α-helix | 280-292 | 13 | |
| β-strand | 297-302 | 6 | 1 |
| α-helix | 312-324 | 13 | |
| β-strand | 332-334 | 3 | 1 |
| α-helix | 335-338 | 4 | |
| α-helix | 339-351 | 13 | |
| β-strand | 355-358 | 4 | 3 |
| α-helix | 371-373 | 3 | |
| α-helix | 380-391 | 12 | |
| β-strand | 401-404 | 4 | 3 |
| β-strand | 407 | 1 | 4 |
| β-strand | 413 | 1 | 4 |
| β-strand | 416-420 | 5 | 3 |
| α-helix | 424 | 1 | |
| β-strand | 425 | 1 | 5 |
| β-strand | 429 | 1 | 5 |
| β-strand | 434-436 | 3 | 3 |
| α-helix | 438-448 | 11 | |
| β-strand | 453-455 | 3 | 1 |
| α-helix | 467-473 | 7 | |
| β-strand | 480-482 | 3 | 1 |
| β-strand | 488-489 | 2 | 6 |
| α-helix | 496-499 | 4 | |
| β-strand | 518 | 1 | 2 |
| α-helix | 519-524 | 6 | |
| α-helix | 529-538 | 10 | |
| β-strand | 547-548 | 2 | 6 |
| α-helix | 549 | 1 | |
| α-helix | 551-564 | 14 | |
| β-strand | 567-568 | 2 | 7 |
| β-strand | 570-571 | 2 | 8 |
| β-strand | 574-576 | 3 | 9 |
| β-strand | 578-579 | 2 | 10 |
| β-strand | 613-615 | 3 | 9 |
| β-strand | 647-650 | 4 | 10 |
| β-strand | 661-663 | 3 | 10 |
| β-strand | 681 | 1 | 9 |
| β-strand | 685-687 | 3 | 8 |
| β-strand | 688-692 | 5 | 7 |
| β-strand | 704 | 1 | 11 |
| β-strand | 706 | 1 | 11 |
| β-strand | 720-722 | 3 | 7 |
| β-strand | 726-728 | 3 | 8 |
| α-helix | 730-732 | 3 | |
| β-strand | 742-743 | 2 | 7 |
| β-strand | 748-751 | 4 | 7 |
| β-strand | 761-766 | 6 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamine--tRNA ligase | A | protein | 776 | Homo sapiens | P47897 (AlphaFold model) |
>4YE8_1 Glutamine--tRNA ligase (chains A) HMAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLHGL ASRLRDTRRLSFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTP EQIEEAVEAAINRHRPQLLVERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGP KLEADLEKKFKVAKARLEETDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYK TPGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICF LRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCH QRGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYR VKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCP VQWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARV GVTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADE TKGFHQVPFAPIVFIERTDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVE SLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLAS LHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
The crystal structure of human GlnRS provides basis for the development of neurological disorders. Ognjenovic, J., Wu, J., Matthies, D. et al. Nucleic Acids Res (2016) 44:3420-3431. DOI 10.1093/nar/gkw082 · PubMed
Other PDB entries of the same protein (UniProt P47897 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4YE8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.