4YH6: IL1RAPL1 ectodomain

Crystal structure of IL1RAPL1 ectodomain. Determined by X-ray diffraction at 3.0 Å resolution. Released 6 May 2015.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 2
Atoms: 5,288
Mol. weight: 84.51 kDa
Ligands: NAG
Released: 6 May 2015

Explore 4YH6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YH6 contains 16 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	32-34	3	1
β-strand	40-44	5	1
β-strand	49-52	4	2
α-helix	54	1
α-helix	55-59	5
α-helix	64-67	4
α-helix	68-70	3
β-strand	73-78	6	1
β-strand	87-88	2	1
α-helix	89	1
β-strand	97-99	3	2
β-strand	102-105	4	2
α-helix	110-112	3
β-strand	114-121	8	1
β-strand	126-136	11	1
β-strand	150-155	6	3
β-strand	160-163	4	4
β-strand	180-183	4	3
β-strand	186	1	3
α-helix	189-191	3
β-strand	194-197	4	4
β-strand	200-203	4	4
β-strand	212-219	8	3
β-strand	224-234	11	3
α-helix	235-237	3
β-strand	243-246	4	5
β-strand	253-256	4	6
β-strand	263-271	9	5
β-strand	280-285	6	6
β-strand	288-289	2	6
α-helix	290-293	4
β-strand	298-300	3	5
α-helix	301-303	3
β-strand	304-309	6	5
β-strand	312-321	10	5
β-strand	331-337	7	6
β-strand	342-350	9	6

Chain B: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	7
β-strand	40-44	5	7
β-strand	49-52	4	8
β-strand	73-78	6	7
β-strand	87-88	2	7
α-helix	89	1
β-strand	96-99	4	8
β-strand	102-105	4	8
α-helix	110-112	3
β-strand	114-121	8	7
β-strand	126-136	11	7
β-strand	150-155	6	9
β-strand	160-163	4	10
α-helix	168-170	3
β-strand	179-183	5	9
β-strand	186	1	9
α-helix	189-191	3
β-strand	194-197	4	10
β-strand	200-203	4	10
β-strand	212-219	8	9
β-strand	224-234	11	9
α-helix	235-237	3
β-strand	243-246	4	11
β-strand	253-256	4	12
β-strand	263-271	9	11
β-strand	280-285	6	12
β-strand	288-289	2	12
β-strand	298-300	3	11
α-helix	301-303	3
β-strand	304-309	6	11
β-strand	312-321	10	11
β-strand	331-337	7	12
β-strand	342-350	9	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-1 receptor accessory protein-like 1	A, B	protein	348	Mus musculus	P59823 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4YH6_1 Interleukin-1 receptor accessory protein-like 1 (chains A, B)
AQPAARDLKVVTKRGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAG
LSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSI
SLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWR
PSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESK
LTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLG
EQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation. Yamagata, A., Yoshida, T., Sato, Y. et al. Nat Commun (2015) 6:6926-6926. DOI 10.1038/ncomms7926 · PubMed

Other PDB entries of the same protein (UniProt P59823 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Y32 2.7 Å, Crystal structure of PTP delta Ig1-Ig2 in complex with IL1RAPL1
4YH7 4.4 Å, Crystal structure of PTPdelta ectodomain in complex with IL1RAPL1

Browse structure collections

About this viewer

MolViewer shows 4YH6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.