Human antibody H2526 in complex with influenza hemagglutinin H1 Solomon Islands/03/2006. Determined by X-ray diffraction at 2.72 Å resolution. Released 27 May 2015.
Explore 4YJZ in 3D Show helices and sheets RCSB PDB PDBe
4YJZ contains 11 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 54-55 | 2 | 1 |
| β-strand | 59 | 1 | 2 |
| α-helix | 61-66 | 6 | |
| α-helix | 69-71 | 3 | |
| β-strand | 80 | 1 | 3 |
| β-strand | 83-84 | 2 | 1 |
| β-strand | 91 | 1 | 2 |
| β-strand | 99 | 1 | 4 |
| α-helix | 102-108 | 7 | |
| β-strand | 112 | 1 | 3 |
| β-strand | 114-119 | 6 | 4 |
| β-strand | 131 | 1 | 5 |
| β-strand | 136-141 | 6 | 6 |
| β-strand | 144-146 | 3 | 6 |
| β-strand | 151-153 | 3 | 4 |
| β-strand | 155 | 1 | 5 |
| β-strand | 157 | 1 | 7 |
| β-strand | 160 | 1 | 7 |
| β-strand | 164-169 | 6 | 8 |
| β-strand | 175-184 | 10 | 4 |
| α-helix | 188-195 | 8 | |
| β-strand | 202-205 | 4 | 8 |
| β-strand | 210-213 | 4 | 8 |
| β-strand | 223 | 1 | 9 |
| β-strand | 226 | 1 | 9 |
| β-strand | 229-237 | 9 | 4 |
| β-strand | 242-247 | 6 | 8 |
| β-strand | 251-254 | 4 | 4 |
| β-strand | 256-261 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 10 |
| β-strand | 9-11 | 3 | 11 |
| β-strand | 18-23 | 6 | 10 |
| α-helix | 26-30 | 5 | |
| β-strand | 34-39 | 6 | 11 |
| β-strand | 46-49 | 4 | 11 |
| β-strand | 50 | 1 | 12 |
| β-strand | 54 | 1 | 12 |
| α-helix | 55-56 | 2 | |
| β-strand | 63-68 | 6 | 10 |
| β-strand | 71-76 | 6 | 10 |
| α-helix | 81-83 | 3 | |
| β-strand | 85-93 | 9 | 11 |
| β-strand | 98-101 | 4 | 11 |
| β-strand | 105-108 | 4 | 11 |
| β-strand | 203-207 | 5 | 13 |
| β-strand | 210-211 | 2 | 14 |
| β-strand | 218-225 | 8 | 13 |
| β-strand | 234-239 | 6 | 14 |
| β-strand | 245-252 | 8 | 14 |
| β-strand | 257-260 | 4 | 14 |
| α-helix | 262-264 | 3 | |
| β-strand | 268-273 | 6 | 13 |
| β-strand | 278-283 | 6 | 13 |
| α-helix | 288-290 | 3 | |
| β-strand | 292-299 | 8 | 14 |
| α-helix | 300-301 | 2 | |
| α-helix | 308-311 | 4 | |
| β-strand | 315-318 | 4 | 14 |
| β-strand | 322-325 | 4 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemagglutinin | E | protein | 222 | Influenza A virus | A7UPX0 |
| scFv H2526 | L | protein | 269 | Homo sapiens |
>4YJZ_1 Hemagglutinin (chains E) APLQLGNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSS VSSFERFEIFPKESSWPNHTTTGVSASCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANN KEKEVLVLWGVHHPPNIGDQRALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRIN YYWTLLEPGDTIIFEANGNLIAPRYAFALSRGFGSGLEVLFQ
>4YJZ_2 scFv H2526 (chains L) QSVLTQPLSAPGTPGQRVTISCSGSSSNVGTNAVDWYQRLPGTAPKLLIYYNNQRPSGVP DRFSGSKSGTSASLAISGLRSEDEADYYCATWDNSLNDRVFGGGTKLTVLGGGGGGSGGG GSGGGGSQVQLVQSGAEVRKPGSSVKVSCKASRGTFSNHAVSWVRQAPGHGLEWLGGLIP IFSTPHYAQKFQGRVTITADESTNTVHMELSSLRSEDTAVYYCAREIPGATSGPDHFFFY GMDVWGQGTTVAVSSASGSSGSGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Viral receptor-binding site antibodies with diverse germline origins. Schmidt, A.G., Therkelsen, M.D., Stewart, S. et al. Cell (2015) 161:1026-1034. DOI 10.1016/j.cell.2015.04.028 · PubMed
Other PDB entries of the same protein (UniProt A7UPX0), best resolution first:
MolViewer shows 4YJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.