4YM4: Truncated Human TIFA

Truncated Human TIFA in complex with its Thr9 phosphorylated N-terminal peptide 1-15. Determined by X-ray diffraction at 3.12 Å resolution. Released 21 Oct 2015.

Method: X-ray diffraction
Resolution: 3.12 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,240
Mol. weight: 18.3 kDa
Released: 21 Oct 2015

Explore 4YM4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YM4 contains 3 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	1
α-helix	30-33	4
β-strand	39-42	4	1
β-strand	46-50	5	2
β-strand	58-59	2	2
β-strand	68-76	9	2
β-strand	83-89	7	2
β-strand	96-98	3	1
β-strand	101-103	3	1
β-strand	108-110	3	2
α-helix	111-112	2
β-strand	114-119	6	1
β-strand	122-129	8	1
β-strand	136-143	8	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TRAF-interacting protein with FHA domain-containing protein A	A	protein	141	Homo sapiens	Q96CG3 (AlphaFold model)
TRAF-interacting protein with FHA domain-containing protein A	B	protein	12	Homo sapiens	Q96CG3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4YM4_1 TRAF-interacting protein with FHA domain-containing protein A (chains A)
EETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQ
FSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKE
DGESLEFFETQFILSPRSLLQ

Sequence of entity 2 (B), FASTA

>4YM4_2 TRAF-interacting protein with FHA domain-containing protein A (chains B)
MTSFEDADTEET

Primary citation

Uncovering the Mechanism of Forkhead-Associated Domain-Mediated TIFA Oligomerization That Plays a Central Role in Immune Responses. Weng, J.H., Hsieh, Y.C., Huang, C.C. et al. Biochemistry (2015) 54:6219-6229. DOI 10.1021/acs.biochem.5b00500 · PubMed

Other PDB entries of the same protein (UniProt Q96CG3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6A33 2.1 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
5ZUJ 2.6 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
4ZGI 2.7 Å, Structure of Truncated Human TIFA

Browse structure collections

About this viewer

MolViewer shows 4YM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.