4YOS: P107 pocket domain

p107 pocket domain complexed with LIN52 peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 27 May 2015.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Homo sapiens, Myotis davidii, Gallus gallus
Chains: 2
Atoms: 2,970
Mol. weight: 45.86 kDa
Released: 27 May 2015

Explore 4YOS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YOS contains 26 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	392-401	10
α-helix	410-417	8
α-helix	424-442	19
α-helix	454-477	24
α-helix	480-483	4
α-helix	489-492	4
α-helix	495-512	18
α-helix	521-525	5
α-helix	530-533	4
α-helix	535-543	9
α-helix	549-564	16
α-helix	566-568	3
α-helix	573-580	8
α-helix	588-592	5
α-helix	787-804	18
α-helix	805-808	4
α-helix	816-830	15
α-helix	832-835	4
α-helix	840-853	14
α-helix	863-868	6
α-helix	876-880	5
β-strand	882-883	2	1
β-strand	927-928	2	1
α-helix	930-933	4
α-helix	934-938	5
α-helix	939-947	9
α-helix	961-963	3

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma-like protein 1,Retinoblastoma-like protein 1	A	protein	369	Homo sapiens, Myotis davidii	L5LUA8, P28749 (AlphaFold model)
Protein lin-52 homolog	E	protein	20	Gallus gallus	Q5ZJQ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4YOS_1 Retinoblastoma-like protein 1,Retinoblastoma-like protein 1 (chains A)
GEFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTD
EQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLE
IVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILESLA
WSHDSALWEALQVSANKVPTCEEVIFPNNFETGRPKRTGSLALFYRKVYHLASVRLRDLC
LKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKS
YRNQPQANSHVYRSVLLKSIKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPL
SPFPHIKQQ

Sequence of entity 2 (E), FASTA

>4YOS_2 Protein lin-52 homolog (chains E)
EASLLSFEKLDRASPDLWPE

Primary citation

Structural mechanisms of DREAM complex assembly and regulation. Guiley, K.Z., Liban, T.J., Felthousen, J.G. et al. Genes Dev (2015) 29:961-974. DOI 10.1101/gad.257568.114 · PubMed

Browse structure collections

About this viewer

MolViewer shows 4YOS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.