4Z18: Human pd-L1

Crystal structure of human pd-L1. Determined by X-ray diffraction at 1.95 Å resolution. Released 15 Apr 2015.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,484
Mol. weight: 50.95 kDa
Released: 15 Apr 2015

Explore 4Z18 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z18 contains 9 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
β-strand	27-31	5	2
β-strand	36-41	6	1
α-helix	50-52	3
β-strand	54-59	6	2
β-strand	62-68	7	2
β-strand	71-72	2	2
α-helix	74-76	3
α-helix	79-81	3
β-strand	85-87	3	1
α-helix	90-92	3
β-strand	96-101	6	1
α-helix	106-108	3
β-strand	110-117	8	2
β-strand	121-131	11	2
β-strand	132	1	3
β-strand	138-145	8	4
β-strand	150-159	10	4
β-strand	160	1	3
β-strand	164-169	6	5
β-strand	174-175	2	5
β-strand	177-183	7	4
β-strand	191-200	10	4
β-strand	206-213	8	5
β-strand	218-225	8	5

Chain B: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	6
β-strand	27-31	5	7
β-strand	36-41	6	6
β-strand	54-59	6	7
β-strand	62-68	7	7
β-strand	71-73	3	7
α-helix	79-81	3
β-strand	85-87	3	6
α-helix	89-92	4
β-strand	96-101	6	6
α-helix	106-108	3
β-strand	110-117	8	7
β-strand	121-131	11	7
β-strand	132	1	8
β-strand	137-145	9	4
β-strand	150-159	10	4
β-strand	160	1	8
β-strand	163-169	7	9
β-strand	178-183	6	4
α-helix	190	1
β-strand	191-200	10	4
β-strand	206-213	8	9
β-strand	218-225	8	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death 1 ligand 1	A, B	protein	222	Homo sapiens	Q9NZQ7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4Z18_1 Programmed cell death 1 ligand 1 (chains A, B)
MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQ
HSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKI
NQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTL
RINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERT

Primary citation

CRYSTAL STRUCTURE OF HUMAN PD-L1. Fedorov, A.A., Fedorov, E.V., Samantha, D. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NZQ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O45 0.99 Å, Structure of human PD-L1 in complex with inhibitor
8ALX 1.1 Å, Structure of human PD-L1 in complex with inhibitor
6NP9 1.27 Å, PD-L1 IgV domain V76T with fragment
9I0U 1.46 Å, Structure of human PD-L1 in complex with clinically evaluated inhibitor
6YCR 1.54 Å, Structure of human PD-L1 in complex with inhibitor
8AOK 1.6 Å, Complex of PD-L1 with VHH6
13DT 1.64 Å, Structure of FabS1CE2_P4a in complex with the N-terminal domain of PD-L1
7CZD 1.64 Å, Crystal structure of PD-L1 in complex with a VHH
5JDS 1.7 Å, Crystal structure of PD-L1 complexed with a nanobody at 1.7 Angstron resolution
5N2F 1.7 Å, Structure of PD-L1/small-molecule inhibitor complex
9QSM 1.75 Å, small molecule inhibitor in complex with PD-L1
8ZNL 1.77 Å, PD-L1 de novo designed binder with picomolar binding affinity

Browse structure collections

About this viewer

MolViewer shows 4Z18 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.