Structure of Factor Inhibiting HIF (FIH) in complex with Fe, NO, and NOG. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Jan 2016.
Explore 4Z1V in 3D Show helices and sheets RCSB PDB PDBe
4Z1V contains 21 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-17 | 2 | |
| β-strand | 18-19 | 2 | 1 |
| α-helix | 20-22 | 3 | |
| β-strand | 24-25 | 2 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 39-41 | 3 | 2 |
| α-helix | 42-43 | 2 | |
| β-strand | 44-45 | 2 | 3 |
| α-helix | 50-57 | 8 | |
| β-strand | 62-64 | 3 | 3 |
| α-helix | 71-75 | 5 | |
| α-helix | 78-84 | 7 | |
| β-strand | 89-95 | 7 | 3 |
| β-strand | 99 | 1 | 2 |
| α-helix | 105-108 | 4 | |
| β-strand | 120-124 | 5 | 3 |
| α-helix | 125-136 | 12 | |
| β-strand | 143-149 | 7 | 3 |
| α-helix | 156-163 | 8 | |
| α-helix | 167-176 | 10 | |
| β-strand | 182-184 | 3 | 3 |
| β-strand | 186-190 | 5 | 3 |
| β-strand | 195-199 | 5 | 2 |
| β-strand | 204-211 | 8 | 3 |
| β-strand | 214-219 | 6 | 2 |
| α-helix | 221-223 | 3 | |
| α-helix | 224-227 | 4 | |
| β-strand | 229 | 1 | 4 |
| α-helix | 230-231 | 2 | |
| β-strand | 239 | 1 | 2 |
| β-strand | 240 | 1 | 4 |
| α-helix | 253-257 | 5 | |
| β-strand | 260-265 | 6 | 2 |
| β-strand | 270-273 | 4 | 3 |
| β-strand | 278-283 | 6 | 2 |
| α-helix | 284 | 1 | |
| β-strand | 290-297 | 8 | 3 |
| α-helix | 298-303 | 6 | |
| α-helix | 310-311 | 2 | |
| α-helix | 312-329 | 18 | |
| α-helix | 333-335 | 3 | |
| α-helix | 336-344 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hypoxia-inducible factor 1-alpha inhibitor | A | protein | 352 | Homo sapiens | Q9NWT6 (AlphaFold model) |
>4Z1V_1 Hypoxia-inducible factor 1-alpha inhibitor (chains A) GSHMAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIE NEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPR SNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKR GWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCD RQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWY KGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Water and common crystallization additives (PEG, SO4) are not listed.
Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH. Taabazuing, C.Y., Fermann, J., Garman, S. et al. Biochemistry (2016) 55:277-286. DOI 10.1021/acs.biochem.5b01003 · PubMed
Other PDB entries of the same protein (UniProt Q9NWT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Z1V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.