Human Argonaute2 Bound to t1-G Target RNA. Determined by X-ray diffraction at 1.6 Å resolution. Released 23 Sept 2015.
Explore 4Z4D in 3D Show helices and sheets RCSB PDB PDBe
4Z4D contains 44 α-helices and 51 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-26 | 2 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 28 | 1 | |
| β-strand | 36-42 | 7 | 2 |
| β-strand | 44-48 | 5 | 3 |
| β-strand | 53-62 | 10 | 4 |
| α-helix | 68-81 | 14 | |
| β-strand | 93-94 | 2 | 4 |
| β-strand | 99-102 | 4 | 4 |
| β-strand | 113-117 | 5 | 4 |
| β-strand | 128-139 | 12 | 4 |
| α-helix | 140-147 | 8 | |
| α-helix | 156-167 | 12 | |
| α-helix | 170-173 | 4 | |
| β-strand | 175-177 | 3 | 3 |
| β-strand | 180-183 | 4 | 3 |
| α-helix | 184-185 | 2 | |
| β-strand | 191-193 | 3 | 3 |
| β-strand | 196-207 | 12 | 3 |
| β-strand | 213-225 | 13 | 3 |
| β-strand | 229 | 1 | 5 |
| α-helix | 230-238 | 9 | |
| α-helix | 243-245 | 3 | |
| α-helix | 250-251 | 2 | |
| α-helix | 252-262 | 11 | |
| β-strand | 266-268 | 3 | 5 |
| β-strand | 278-280 | 3 | 5 |
| β-strand | 281-288 | 8 | 6 |
| β-strand | 293-294 | 2 | 7 |
| β-strand | 306-307 | 2 | 7 |
| α-helix | 308-316 | 9 | |
| β-strand | 326-330 | 5 | 6 |
| β-strand | 337-340 | 4 | 6 |
| α-helix | 341-343 | 3 | |
| β-strand | 345-346 | 2 | 5 |
| α-helix | 347 | 1 | |
| α-helix | 350 | 1 | |
| β-strand | 351 | 1 | 3 |
| α-helix | 352 | 1 | |
| α-helix | 355-357 | 3 | |
| α-helix | 358-368 | 11 | |
| α-helix | 372-386 | 15 | |
| α-helix | 388-390 | 3 | |
| α-helix | 392-396 | 5 | |
| β-strand | 400-401 | 2 | 3 |
| α-helix | 405 | 1 | |
| β-strand | 406-412 | 7 | 2 |
| α-helix | 413-417 | 5 | |
| β-strand | 418-419 | 2 | 8 |
| β-strand | 427-428 | 2 | 8 |
| β-strand | 431 | 1 | 9 |
| β-strand | 434 | 1 | 9 |
| β-strand | 444 | 1 | 10 |
| α-helix | 445-447 | 3 | |
| β-strand | 448 | 1 | 11 |
| β-strand | 451-455 | 5 | 12 |
| α-helix | 464-480 | 17 | |
| β-strand | 485 | 1 | 11 |
| β-strand | 491-494 | 4 | 12 |
| α-helix | 498-500 | 3 | |
| α-helix | 501-511 | 11 | |
| β-strand | 517-522 | 6 | 12 |
| α-helix | 527-533 | 7 | |
| α-helix | 534-540 | 7 | |
| β-strand | 544-548 | 5 | 12 |
| α-helix | 550-553 | 4 | |
| α-helix | 557-570 | 14 | |
| β-strand | 574 | 1 | 10 |
| β-strand | 577-578 | 2 | 8 |
| α-helix | 580-582 | 3 | |
| α-helix | 585-588 | 4 | |
| β-strand | 591-599 | 9 | 2 |
| α-helix | 600-602 | 3 | |
| α-helix | 608-609 | 2 | |
| β-strand | 610-617 | 8 | 2 |
| β-strand | 625-632 | 8 | 2 |
| α-helix | 642-657 | 16 | |
| β-strand | 663-669 | 7 | 2 |
| α-helix | 673-675 | 3 | |
| α-helix | 676-694 | 19 | |
| β-strand | 701-708 | 8 | 2 |
| β-strand | 715-717 | 3 | 2 |
| α-helix | 720-722 | 3 | |
| β-strand | 724 | 1 | 13 |
| β-strand | 729 | 1 | 13 |
| α-helix | 730-731 | 2 | |
| β-strand | 734-736 | 3 | 2 |
| β-strand | 745 | 1 | 1 |
| β-strand | 747-751 | 5 | 2 |
| β-strand | 763-770 | 8 | 2 |
| α-helix | 776-786 | 11 | |
| β-strand | 795 | 1 | 9 |
| α-helix | 801-816 | 16 | |
| α-helix | 837-846 | 10 | |
| α-helix | 847-849 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein argonaute-2 | A | protein | 859 | Homo sapiens | Q9UKV8 (AlphaFold model) |
| RNA (5'-r(p*up*up*cp*ap*cp*ap*up*up*gp*cp*cp*cp*ap*ap*gp*up*cp*up*up*u)-3') | B | RNA | 21 | synthetic construct | |
| RNA (5'-r(*cp*ap*ap*up*gp*up*gp*ap*g)-3') | D | RNA | 11 | synthetic construct |
>4Z4D_1 Protein argonaute-2 (chains A) MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELD IKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLP GEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRS FFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDF KSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQES GQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ TSTMIRATARSAPDRQEEISKLMRSADFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD AGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVL GMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTH PPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFK PTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDK NERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQ ILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ ALAKAVQVHQDTLRTMYFA
>4Z4D_2 RNA (5'-R(P*UP*UP*CP*AP*CP*AP*UP*UP*GP*CP*CP*CP*AP*AP*GP*UP*CP*UP*UP*U)-3') (chains B) UUCACAUUGCCCAAGUCUCUU
>4Z4D_3 RNA (5'-R(*CP*AP*AP*UP*GP*UP*GP*AP*G)-3') (chains D) CAAUGUGAGAA
Water-mediated recognition of t1-adenosine anchors Argonaute2 to microRNA targets. Schirle, N.T., Sheu-Gruttadauria, J., Chandradoss, S.D. et al. Elife (2015) 4. DOI 10.7554/eLife.07646 · PubMed
Other PDB entries of the same protein (UniProt Q9UKV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Z4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.