4Z7V: L3-12 complex

L3-12 complex. Determined by X-ray diffraction at 2.65 Å resolution. Released 3 Jun 2015.

Method: X-ray diffraction
Resolution: 2.65 Å
Organisms: Homo sapiens, Triticum aestivum
Chains: 10
Atoms: 13,077
Mol. weight: 199.19 kDa
Ligands: NAG
Released: 3 Jun 2015

Explore 4Z7V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z7V contains 53 α-helices and 137 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	11	1
β-strand	19-26	8	1
β-strand	29-35	7	1
β-strand	40-43	4	1
α-helix	46-51	6
α-helix	56-76	21
α-helix	81-87	7
β-strand	88-93	6	2
β-strand	103-112	10	2
β-strand	118-123	6	3
β-strand	126-128	3	3
β-strand	132-134	3	2
β-strand	138-139	2	2
β-strand	145-153	9	2
β-strand	161-166	6	3
β-strand	174-178	5	3

Chain B: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	23-32	10	1
β-strand	35-41	7	1
β-strand	47-49	3	1
α-helix	55-63	9
α-helix	65-74	10
α-helix	75-80	6
α-helix	81-88	8
α-helix	90-92	3
β-strand	95	1	4
α-helix	96-97	2
β-strand	98-103	6	5
β-strand	115-122	8	5
β-strand	123	1	4
β-strand	128-131	4	6
β-strand	142-144	3	5
α-helix	145-147	3
β-strand	148-149	2	5
β-strand	155-161	7	5
β-strand	171-176	6	6
α-helix	183	1
β-strand	184-188	5	6

Chain C: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	11	7
β-strand	19-26	8	7
β-strand	29-35	7	7
β-strand	40-43	4	7
α-helix	46-51	6
β-strand	53	1	8
α-helix	56-76	21
α-helix	81-87	7
β-strand	88-93	6	9
β-strand	103-112	10	9
β-strand	118-123	6	10
β-strand	126-128	3	10
β-strand	132-134	3	9
β-strand	138-139	2	9
β-strand	145-153	9	9
β-strand	161-166	6	10
β-strand	174-178	5	10

Chain D: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
β-strand	8-18	11	7
β-strand	23-32	10	7
β-strand	35-41	7	7
β-strand	47-49	3	7
α-helix	55-63	9
α-helix	65-74	10
α-helix	75-80	6
α-helix	81-88	8
α-helix	90-92	3
β-strand	95	1	11
α-helix	96-97	2
β-strand	98-103	6	12
β-strand	115-122	8	12
β-strand	123	1	11
β-strand	128-131	4	13
β-strand	143-144	2	12
α-helix	145-147	3
β-strand	148-149	2	12
β-strand	155-160	6	12
α-helix	165-166	2
β-strand	172-176	5	13
α-helix	183	1
β-strand	184-187	4	13

Chain E: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	14
β-strand	10-14	5	15
β-strand	17-24	8	14
β-strand	37-44	8	15
β-strand	51-56	6	15
β-strand	65-67	3	14
β-strand	77-80	4	14
β-strand	86-94	9	14
α-helix	96-98	3
β-strand	100-108	9	15
β-strand	122-127	6	15
β-strand	136-142	7	16
β-strand	149-154	6	16
α-helix	162-165	4
β-strand	170-172	3	16
α-helix	173-175	3
β-strand	176-180	5	16
α-helix	181-183	3
β-strand	185-194	10	16
α-helix	201-204	4
β-strand	215	1	16

Chain F: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	17
β-strand	10-14	5	18
β-strand	19-24	6	17
α-helix	25-26	2
β-strand	38-45	8	18
β-strand	49-57	9	18
β-strand	64-68	5	18
β-strand	76-80	5	17
β-strand	87-91	5	17
α-helix	96-98	3
β-strand	100-107	8	18
β-strand	117-118	2	18
β-strand	122-127	6	18
α-helix	130-132	3
β-strand	134	1	19
β-strand	137-142	6	16
α-helix	143-144	2
α-helix	145-151	7
β-strand	153-163	11	16
β-strand	164	1	19
β-strand	168-174	7	20
β-strand	177-179	3	20
β-strand	183-185	3	16
α-helix	189	1
β-strand	190-191	2	16
β-strand	201-210	10	16
α-helix	211-215	5
β-strand	220-227	8	20
β-strand	230	1	21
α-helix	241-242	2
β-strand	244	1	21
β-strand	246-253	8	20

Chain G: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	22
β-strand	10-14	5	23
β-strand	17-24	8	22
β-strand	37-44	8	23
β-strand	51-56	6	23
β-strand	65-67	3	22
β-strand	77-80	4	22
β-strand	86-94	9	22
α-helix	96-98	3
β-strand	100-108	9	23
β-strand	122-127	6	23
β-strand	136-140	5	24
β-strand	141-142	2	25
β-strand	149-154	6	24
α-helix	162-165	4
β-strand	170-172	3	24
α-helix	173-175	3
β-strand	176-180	5	24
α-helix	181-183	3
β-strand	185-194	10	24
β-strand	215	1	24

Chain H: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	26
β-strand	10-14	5	27
β-strand	19-24	6	26
β-strand	38-45	8	27
β-strand	49-57	9	27
β-strand	64-68	5	27
β-strand	76-80	5	26
β-strand	87-91	5	26
α-helix	96-98	3
β-strand	100-107	8	27
β-strand	117-118	2	27
β-strand	122-127	6	27
α-helix	130-132	3
β-strand	134	1	28
β-strand	137-142	6	25
α-helix	143-144	2
α-helix	145-151	7
β-strand	153-163	11	25
β-strand	164	1	28
β-strand	168-174	7	29
β-strand	177-179	3	29
β-strand	183-185	3	25
α-helix	189	1
β-strand	190-191	2	25
α-helix	199-200	2
β-strand	201-210	10	25
α-helix	211-215	5
β-strand	220-227	8	29
β-strand	230	1	30
α-helix	241-242	2
β-strand	244	1	30
β-strand	246-253	8	29

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class II HLA-DQ-alpha chain	A, C	protein	192	Homo sapiens	Q30069 (AlphaFold model)
MHC class II HLA-DQ-beta-1	B, D	protein	213	Homo sapiens	P01920 (AlphaFold model)
T-cell receptor, L3-12 alpha chain	E, G	protein	204	Homo sapiens	K7N5N2 (AlphaFold model)
T-cell receptor, L3-12 beta chain	F, H	protein	244	Homo sapiens	P01850 (AlphaFold model)
deamidated DQ8-glia-alpha1 peptide	I, J	protein	18	Triticum aestivum	P18573

Sequence of entity 1 (A, C), FASTA

>4Z7V_1 MHC class II HLA-DQ-alpha chain (chains A, C)
EDIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQ
FALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVV
NITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKH
WEPETSGDDDDK

Sequence of entity 2 (B, D), FASTA

>4Z7V_2 MHC class II HLA-DQ-beta-1 (chains B, D)
GGSIEGRGGSGASRDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVY
RAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTE
ALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQR
GDVYTCHVEHPSLQNPIIVEWRAQSTGGDDDDK

Sequence of entity 3 (E, G), FASTA

>4Z7V_3 T-CELL RECEPTOR, L3-12 ALPHA CHAIN (chains E, G)
DAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMA
SLAIAEDRKSSTLILHRATLRDAAVYYCILRDSRAQKLVFGQGTRLTINPNIQNPDPAVY
QLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSD
FACANAFNNSIIPEDTFFPSPESS

Sequence of entity 4 (F, H), FASTA

>4Z7V_4 T-CELL RECEPTOR, L3-12 BETA CHAIN (chains F, H)
DSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNI
LERFSAQQFPDLHSELNLSSLELGDSALYFCASSAGTSGEYEQYFGPGTRLTVTEDLKNV
FPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQ
PALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW
GRAD

Sequence of entity 5 (I, J), FASTA

>4Z7V_5 deamidated DQ8-glia-alpha1 peptide (chains I, J)
APSGEGSFQPSQENPQGS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Determinants of Gliadin-Specific T Cell Selection in Celiac Disease. Petersen, J., van Bergen, J., Loh, K.L. et al. J Immunol (2015) 194:6112-6122. DOI 10.4049/jimmunol.1500161 · PubMed

Other PDB entries of the same protein (UniProt Q30069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DFX 2.03 Å, human diabetogenic TCR T1D3 in complex with DQ8-p8E9E peptide
6XC9 2.4 Å, Immune receptor complex
8VD0 2.4 Å, Human TCR ET650-4 in complex with DQ8-InsC8-15-IAPP2
5KS9 2.55 Å, Bel502-DQ8-glia-alpha1 complex
8VCX 2.59 Å, Human TCR A2.13 in complex with DQ8-InsCpep
8VCY 2.6 Å, Human TCR A2.13 in complex with DQ8-InsC8-15NPY
8VDD 2.6 Å, Crystal structure of Proinsulin C-peptide bound to HLA-DQ8
4Z7U 2.7 Å, S13 complex
4Z7W 2.89 Å, T316 complex
6XCO 2.9 Å, Immune receptor complex
8VD2 2.9 Å, Human TCR ET650-4 in complex with DQ8-InsC8-15-IAPP1
6XCP 3.3 Å, Immune receptor complex

Browse structure collections

About this viewer

MolViewer shows 4Z7V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.