4ZCH: Single-chain human APRIL-BAFF-BAFF Heterotrimer

Name: PDB 4ZCH: Single-chain human APRIL-BAFF-BAFF Heterotrimer
Published: 2015-05-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Single-chain human APRIL-BAFF-BAFF Heterotrimer. Determined by X-ray diffraction at 2.43 Å resolution. Released 13 May 2015.

Method: X-ray diffraction
Resolution: 2.43 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,997
Mol. weight: 97.59 kDa
Ligands: 144
Released: 13 May 2015

Explore 4ZCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZCH contains 10 α-helices and 76 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	9-18	10	1
β-strand	26-36	11	1
β-strand	40-42	3	1
β-strand	47-49	3	1
β-strand	53-63	11	1
β-strand	69-77	9	1
β-strand	82-91	10	1
β-strand	101-111	11	1
β-strand	116-121	6	1
β-strand	128-129	2	1
β-strand	136-141	6	1
β-strand	154-159	6	2
α-helix	164-165	2
β-strand	166-168	3	3
β-strand	171-173	3	3
β-strand	176-182	7	2
β-strand	186-189	4	3
β-strand	192-195	4	3
β-strand	199-209	11	2
β-strand	215-223	9	3
β-strand	234-243	10	3
β-strand	251-261	11	2
β-strand	266-271	6	3
β-strand	278	1	2
β-strand	286-291	6	2
α-helix	292-293	2
β-strand	305-310	6	4
α-helix	315-316	2
β-strand	317-319	3	5
β-strand	322-324	3	5
α-helix	325-326	2
β-strand	327-333	7	4
β-strand	337-340	4	5
β-strand	343-346	4	5
β-strand	350-360	11	4
β-strand	366-377	12	5
β-strand	382-394	13	5
β-strand	402-412	11	4
β-strand	417-422	6	5
β-strand	429	1	4
β-strand	437-443	7	4

Chain B: 6 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	9-18	10	6
β-strand	26-36	11	6
β-strand	40-44	5	6
β-strand	46-49	4	6
β-strand	53-63	11	6
α-helix	69	1
β-strand	70	1	7
β-strand	73-78	6	6
β-strand	81-87	7	6
β-strand	90	1	7
β-strand	101-111	11	6
β-strand	116-121	6	6
β-strand	128	1	6
β-strand	136-141	6	6
β-strand	154-159	6	8
α-helix	164-165	2
β-strand	166-168	3	9
β-strand	171-173	3	9
α-helix	174-175	2
β-strand	176-182	7	8
β-strand	186-189	4	9
β-strand	192-195	4	9
β-strand	199-209	11	8
β-strand	215-223	9	9
β-strand	234-243	10	9
β-strand	251-261	11	8
β-strand	266-271	6	9
β-strand	278	1	8
β-strand	286-291	6	8
α-helix	292-293	2
β-strand	305-310	6	10
α-helix	315-316	2
β-strand	317-318	2	11
β-strand	323-324	2	11
α-helix	325-326	2
β-strand	327-333	7	10
β-strand	337-340	4	11
β-strand	343-346	4	11
β-strand	350-360	11	10
β-strand	366-377	12	11
β-strand	382-394	13	11
β-strand	402-412	11	10
β-strand	417-422	6	11
β-strand	429-430	2	10
β-strand	437-442	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor ligand superfamily member 13,Tumor necrosis factor ligand superfamily member…	A, B	protein	438	Homo sapiens	O75888 (AlphaFold model), Q9Y275 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ZCH_1 Tumor necrosis factor ligand superfamily member 13,Tumor necrosis factor ligand superfamily member 13B,Tumor necrosis factor ligand superfamily member 13B (chains A, B)
HSVLHLVPINAASKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDV
TFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARA
KLNLSPHGTFLGFVKLGGGGSETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSAL
EEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPE
TLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLGGGGSETVTQDCL
QLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYA
MGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPREN
AQISLDGDVTFFGALKLL

Ligands and cofactors

ID	Name	Formula	Copies
144	Tris-hydroxymethyl-methyl-ammonium	C4 H12 N O3	1

Primary citation

Stoichiometry of Heteromeric BAFF and APRIL Cytokines Dictates Their Receptor Binding and Signaling Properties. Schuepbach-Mallepell, S., Das, D., Willen, L. et al. J Biol Chem (2015) 290:16330-16342. DOI 10.1074/jbc.M115.661405 · PubMed

Browse structure collections

About this viewer

MolViewer shows 4ZCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.