Crystal structure of Mouse Syndesmos protein. Determined by X-ray diffraction at 2.01 Å resolution. Released 20 Apr 2016.
Explore 4ZG0 in 3D Show helices and sheets RCSB PDB PDBe
4ZG0 contains 19 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9 | 1 | |
| β-strand | 10-12 | 3 | 1 |
| α-helix | 14-17 | 4 | |
| β-strand | 25-40 | 16 | 1 |
| β-strand | 44-55 | 12 | 1 |
| β-strand | 60-61 | 2 | 1 |
| β-strand | 64-67 | 4 | 1 |
| α-helix | 74-82 | 9 | |
| α-helix | 93-95 | 3 | |
| β-strand | 96-101 | 6 | 1 |
| α-helix | 102-103 | 2 | |
| β-strand | 108-117 | 10 | 1 |
| α-helix | 119-129 | 11 | |
| β-strand | 135 | 1 | 1 |
| β-strand | 139-145 | 7 | 1 |
| α-helix | 146 | 1 | |
| β-strand | 149 | 1 | 2 |
| β-strand | 156 | 1 | 2 |
| α-helix | 157-161 | 5 | |
| β-strand | 165 | 1 | 1 |
| α-helix | 167-179 | 13 | |
| α-helix | 185-203 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-10 | 2 | |
| β-strand | 11-12 | 2 | 3 |
| α-helix | 14-17 | 4 | |
| β-strand | 25-40 | 16 | 3 |
| β-strand | 44-55 | 12 | 3 |
| β-strand | 60-61 | 2 | 3 |
| β-strand | 64-67 | 4 | 3 |
| α-helix | 74-80 | 7 | |
| α-helix | 93-95 | 3 | |
| β-strand | 96-101 | 6 | 3 |
| β-strand | 108-117 | 10 | 3 |
| α-helix | 119-129 | 11 | |
| β-strand | 135 | 1 | 3 |
| β-strand | 139-145 | 7 | 3 |
| α-helix | 146 | 1 | |
| β-strand | 149 | 1 | 4 |
| β-strand | 156 | 1 | 4 |
| α-helix | 157-161 | 5 | |
| β-strand | 165 | 1 | 3 |
| α-helix | 167-179 | 13 | |
| α-helix | 185-203 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein syndesmos | A, B | protein | 212 | Mus musculus | Q8VHN8 (AlphaFold model) |
>4ZG0_1 Protein syndesmos (chains A, B) GMSTTTVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGL LGFPGGFVDRRFWSLEDGLNRVLGLGLGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTL EQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFALKV LNMMPSEKLAEALASATEKQKKALEKLLPPSS
Crystal structure of syndesmos and its interaction with Syndecan-4 proteoglycan. Kim, H., Yoo, J., Lee, I. et al. Biochem Biophys Res Commun (2015) 463:762-767. DOI 10.1016/j.bbrc.2015.06.010 · PubMed
Other PDB entries of the same protein (UniProt Q8VHN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.