4ZKB: The chemokine binding protein of orf virus

The chemokine binding protein of orf virus complexed with CCL3. Determined by X-ray diffraction at 2.9 Å resolution. Released 8 Jul 2015.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Orf virus (strain NZ2), Homo sapiens
Chains: 2
Atoms: 1,919
Mol. weight: 39.94 kDa
Released: 8 Jul 2015

Explore 4ZKB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZKB contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	12-20	9
β-strand	27-37	11	1
β-strand	49-59	11	2
β-strand	66-76	11	2
β-strand	79-88	10	2
β-strand	94-101	8	1
β-strand	108-116	9	1
α-helix	117-118	2
α-helix	129-141	13
β-strand	143-149	7	2
β-strand	202	1	1
β-strand	205-209	5	2
β-strand	214-225	12	1
α-helix	228-230	3
β-strand	237-242	6	1
α-helix	245-251	7
α-helix	252-254	3
β-strand	260-265	6	1

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	2
β-strand	27	1	3
β-strand	40-42	3	3
β-strand	48-50	3	3
α-helix	57	1
α-helix	58-62	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chemokine binding protein	A	protein	276	Orf virus (strain NZ2)	Q2F862
C-C motif chemokine 3	B	protein	75	Homo sapiens	P10147 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZKB_1 Chemokine binding protein (chains A)
APLLESQRSNSEEKANFCSTHNDEVYARFRLQMRVGVRHSPLYTPSNMCMLDIEDSVEDI
EESTEKEYASTATGEAAGVNVSVALVGEGVSIPFSYIGLGFNPSLEDSYLYVNVSSRAPW
VKQTSDLSANGGWGIKQVLEKELLAIQIGCDNQKFPEEPTTTPPSPVTTTLSSTTPDLNE
ENTENTPTTTGASVDRKRNPADIDFSLLVDPRCVTSVDLHVELRDACIDYKQESPLSLKG
KYGDGELVKKEIKDVGKNHNMCSLNLNPGNENLYFQ

Sequence of entity 2 (B), FASTA

>4ZKB_2 C-C motif chemokine 3 (chains B)
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQK
YVSDLELSAHHHHHH

Primary citation

Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Counago, R.M., Knapp, K.M., Nakatani, Y. et al. Structure (2015) 23:1199-1213. DOI 10.1016/j.str.2015.04.023 · PubMed

Other PDB entries of the same protein (UniProt Q2F862), best resolution first:

4P5I 2.25 Å, Crystal structure of the chemokine binding protein from orf virus
4ZK9 2.6 Å, The chemokine binding protein of orf virus complexed with CCL2
4ZKC 3.15 Å, The chemokine binding protein of orf virus complexed with CCL7

Browse structure collections

About this viewer

MolViewer shows 4ZKB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.