4ZMI: Helical domain of S. pombe Taz1

Crystal structure of the Helical domain of S. pombe Taz1. Determined by X-ray diffraction at 2.3 Å resolution. Released 23 Sept 2015.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 1
Atoms: 1,945
Mol. weight: 27.03 kDa
Ligands: CO, MG
Released: 23 Sept 2015

Explore 4ZMI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZMI contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	131-161	31
α-helix	169-176	8
α-helix	178-194	17
α-helix	204-209	6
α-helix	211-217	7
α-helix	221-233	13
α-helix	234-237	4
α-helix	244-256	13
α-helix	263-280	18
α-helix	285-286	2
α-helix	289-294	6
α-helix	302-308	7
α-helix	311-315	5
α-helix	318-329	12
α-helix	337-339	3
α-helix	340-355	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomere length regulator taz1	A	protein	235	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	P79005 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZMI_1 Telomere length regulator taz1 (chains A)
SIWDIEKASLLVNDCQNIANMAEQKVMMVSAIFSESSKDIVNPESFSERLGKETVKDLYE
FNEQLTTKYGLEFRTIFFSYIRKYDAYWCLFEDLEKPLKSIQFFTGLIDLLDNTNKHLTL
RSIVLDALLSADEEDSFYGDALVLFEELVIRYFGTDSNPSIDASEFILSCLPYTSLDALN
VVCGQVWKSQKICDFLKSTIGNTSNSPLQLRASFPAFVNAVIHFLLEFKNVRRLE

Ligands and cofactors

ID	Name	Formula	Copies
CO	Cobalt (II) ion	Co	1
MG	Magnesium ion	Mg	1

Primary citation

Fission yeast telomere-binding protein Taz1 is a functional but not a structural counterpart of human TRF1 and TRF2. Deng, W., Wu, J., Wang, F. et al. Cell Res (2015) 25:881-884. DOI 10.1038/cr.2015.76 · PubMed

Other PDB entries of the same protein (UniProt P79005 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZMK 1.5 Å, Crystal structure of the dimerization domain of S. pombe Taz1
2L3N Solution structure of Rap1-Taz1 fusion protein

Browse structure collections

About this viewer

MolViewer shows 4ZMI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.