4ZOT: Kunitz-type serine protease inhibitor BbKI

Crystal structure of BbKI, a disulfide-free plasma kallikrein inhibitor at 1.4 A resolution. Determined by X-ray diffraction at 1.4 Å resolution. Released 20 May 2015.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Bauhinia bauhinioides
Chains: 1
Atoms: 1,527
Mol. weight: 18.37 kDa
Released: 20 May 2015

Explore 4ZOT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZOT contains 5 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	2	1
β-strand	3	1	1
α-helix	4	1
β-strand	5	1	2
α-helix	10	1
β-strand	11	1	2
α-helix	12	1
β-strand	13	1	3
β-strand	19-23	5	4
β-strand	30-34	5	4
β-strand	44-48	5	4
β-strand	54	1	4
β-strand	57-60	4	4
β-strand	67	1	3
β-strand	69	1	1
β-strand	74-78	5	4
β-strand	87-93	7	4
β-strand	97-103	7	4
β-strand	112-117	6	4
β-strand	120-125	6	4
β-strand	134-141	8	4
β-strand	144-149	6	4
α-helix	154-156	3
β-strand	157-161	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kunitz-type serine protease inhibitor BbKI	A	protein	168	Bauhinia bauhinioides	P83052 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZOT_1 Kunitz-type serine protease inhibitor BbKI (chains A)
SGHSSVVVDTNGQPVSNGADAYYLVPVSHGHAGLALAKIGNEAEPRAVVLDPHHRPGLPV
RFESPLRINIIKESYFLNIKFGPSSSDSGVWDVIQQDPIGLAVKVTDTKSLLGPFKVEKE
GEGYKIVYYPERGQTGLDIGLVHRNDKYYLAVKDGEPCVFKIRKATDE

Primary citation

Structure of BbKI, a disulfide-free plasma kallikrein inhibitor. Zhou, D., Hansen, D., Shabalin, I.G. et al. Acta Crystallogr F Struct Biol Commun (2015) 71:1055-1062. DOI 10.1107/S2053230X15011127 · PubMed

Other PDB entries of the same protein (UniProt P83052 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JOD 1.33 Å, Crystal structure of BbKI complexed with Human Kallikrein 4
7JQK 1.33 Å, Crystal structure of the R64A mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JQN 1.5 Å, Crystal structure of the R64M mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JQO 1.6 Å, Crystal structure of the R64D mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JRX 1.77 Å, Crystal structure of the R64F mutant of Bauhinia Bauhinioides complexed with Bovine…
7JR2 1.85 Å, Crystal structure of the R64M mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JOW 1.91 Å, Crystal structure of BbKI complexed with Human Kallikrein 4
7JR1 2.05 Å, Crystal structure of the R64F mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JOS 2.1 Å, Crystal structure of BbKI complexed with Human Kallikrein 4
7JQV 2.1 Å, Crystal structure of the R64F mutant of Bauhinia Bauhinioides Kallikrein Inhibitor…
7JOE 2.6 Å, Crystal structure of BbKI complexed with Human Kallikrein 4

Browse structure collections

About this viewer

MolViewer shows 4ZOT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.