4ZQA: Sds3 Dimerization Domain

Crystal Structure of the Sds3 Dimerization Domain. Determined by X-ray diffraction at 1.65 Å resolution. Released 15 Jul 2015.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Mus musculus
Chains: 1
Atoms: 866
Mol. weight: 10.4 kDa
Released: 15 Jul 2015

Explore 4ZQA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZQA contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-85	82

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sin3 histone deacetylase corepressor complex component SDS3	A	protein	86	Mus musculus	Q8BR65 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZQA_1 Sin3 histone deacetylase corepressor complex component SDS3 (chains A)
SNAGTLQEYQKRMKKLDQQYRERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKVEL
KENLIAELEEKKKMIENEKLTMELTG

Primary citation

Structural insights into the assembly of the histone deacetylase-associated Sin3L/Rpd3L corepressor complex. Clark, M.D., Marcum, R., Graveline, R. et al. Proc Natl Acad Sci U S A (2015) 112:E3669-E3678. DOI 10.1073/pnas.1504021112 · PubMed

Other PDB entries of the same protein (UniProt Q8BR65 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2N2H Solution structure of Sds3 in complex with Sin3A
7SXI Solution Structure of Sds3 Capped Tudor Domain

Browse structure collections

About this viewer

MolViewer shows 4ZQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.