4ZXB: Fab 83-7 heavy chain

Structure of the human insulin receptor ectodomain, IRDeltabeta construct, in complex with four Fab molecules. Determined by X-ray diffraction at 3.3 Å resolution. Released 24 Feb 2016.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: Mus musculus, Homo sapiens
Chains: 5
Atoms: 12,918
Mol. weight: 202.01 kDa
Ligands: NAG
Released: 24 Feb 2016

Explore 4ZXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZXB contains 57 α-helices and 155 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
β-strand	33-39	7	3
β-strand	46-51	6	3
β-strand	57-59	3	3
α-helix	63-66	4
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	87-89	3
β-strand	91-98	8	3
β-strand	108	1	3
β-strand	112-114	3	3
β-strand	115-116	2	2
α-helix	120-121	2
β-strand	122	1	4
α-helix	123-124	2
β-strand	125-129	5	5
β-strand	140-150	11	5
β-strand	151	1	4
β-strand	156-159	4	6
α-helix	160-162	3
β-strand	164	1	6
β-strand	168-170	3	5
α-helix	171-173	3
β-strand	174-175	2	5
β-strand	180-189	10	5
α-helix	190-192	3
β-strand	199-204	6	6
α-helix	205-207	3
β-strand	209-214	6	6

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	30-31	2	9
β-strand	36-37	2	9
β-strand	39-44	6	8
β-strand	51-55	5	8
β-strand	59-60	2	8
α-helix	61	1
β-strand	68-73	6	7
β-strand	76-81	6	7
α-helix	86-88	3
β-strand	90-96	7	8
β-strand	102-103	2	8
β-strand	107-112	6	8
β-strand	116	1	10
α-helix	117-118	2
β-strand	119-123	5	11
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	11
β-strand	145	1	10
β-strand	150-155	6	12
β-strand	158-160	3	12
β-strand	164-168	5	11
α-helix	169-172	4
β-strand	178-187	10	11
α-helix	188-192	5
β-strand	196-203	8	12
β-strand	206-215	10	12

Chain C: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	13
β-strand	10-12	3	14
β-strand	18-25	8	13
α-helix	29-31	3
β-strand	34-39	6	14
β-strand	45-52	8	14
β-strand	57-60	4	14
α-helix	62-64	3
β-strand	68-73	6	13
α-helix	74-76	3
β-strand	78-83	6	13
β-strand	92-98	7	14
β-strand	102-103	2	14
β-strand	107-111	5	14
α-helix	114-116	3
β-strand	117	1	15
α-helix	118-119	2
β-strand	120-124	5	16
β-strand	137-145	9	16
β-strand	146	1	15
β-strand	151-154	4	17
α-helix	155-157	3
β-strand	163-165	3	16
α-helix	166-168	3
β-strand	169-171	3	16
β-strand	174-182	9	16
β-strand	195-199	5	17
α-helix	200-202	3
β-strand	204-208	5	17

Chain D: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	18
β-strand	10-13	4	19
β-strand	19-25	7	18
β-strand	33-38	6	19
β-strand	44-49	6	19
β-strand	53-54	2	19
α-helix	55	1
β-strand	62-67	6	18
β-strand	70-75	6	18
α-helix	80-82	3
β-strand	85-90	6	19
β-strand	97-98	2	19
β-strand	102-106	5	19
β-strand	111	1	20
β-strand	114-118	5	21
α-helix	119-121	3
α-helix	122-127	6
β-strand	133-139	7	21
β-strand	140	1	20
β-strand	145	1	22
β-strand	160-163	4	21
α-helix	164-167	4
β-strand	173-178	6	21
β-strand	197	1	22

Chain E: 28 helices, 69 β-strands

Element	Residues	Length	Sheet
β-strand	6-14	9	23
α-helix	18-23	6
β-strand	26-38	13	23
α-helix	43-46	4
β-strand	56-57	2	23
β-strand	61-66	6	23
β-strand	81-82	2	23
β-strand	88	1	23
β-strand	91-96	6	23
β-strand	111-112	2	23
β-strand	116-120	5	23
α-helix	133-135	3
β-strand	144-146	3	23
α-helix	149-151	3
β-strand	171	1	24
β-strand	180	1	24
β-strand	182-184	3	25
β-strand	187-188	2	25
α-helix	189-190	2
α-helix	194-196	3
β-strand	201	1	26
α-helix	206	1
β-strand	207	1	26
α-helix	208-209	2
β-strand	212	1	27
β-strand	216	1	28
β-strand	225	1	28
β-strand	228	1	27
β-strand	231-233	3	29
β-strand	236-238	3	29
α-helix	241-242	2
β-strand	246-248	3	29
β-strand	252-254	3	29
α-helix	256-266	11
β-strand	278-280	3	29
β-strand	283-285	3	29
α-helix	288-289	2
β-strand	292-294	3	30
β-strand	300	1	29
β-strand	301-303	3	30
α-helix	308-309	2
β-strand	311-321	11	31
α-helix	324-328	5
β-strand	335-342	8	31
α-helix	352-358	7
β-strand	363-364	2	31
β-strand	368-371	4	31
β-strand	378	1	32
β-strand	387-388	2	31
β-strand	394	1	31
β-strand	398-403	6	31
β-strand	410	1	32
β-strand	420-421	2	31
β-strand	425-429	5	31
β-strand	431	1	33
α-helix	436-446	11
β-strand	457	1	31
β-strand	462	1	33
β-strand	471-473	3	34
β-strand	475-480	6	35
β-strand	485-489	5	35
α-helix	497-499	3
β-strand	500-509	10	34
β-strand	532-534	3	34
β-strand	550-553	4	35
β-strand	561-570	10	34
β-strand	581-583	3	34
α-helix	584-585	2
β-strand	586-589	4	34
α-helix	590-591	2
α-helix	594-598	5
β-strand	599-604	6	36
β-strand	611-616	6	36
α-helix	617-618	2
β-strand	627-631	5	37
β-strand	634	1	37
α-helix	635-637	3
α-helix	639-642	4
α-helix	695-708	14
β-strand	759-763	5	37
β-strand	767-770	4	36
β-strand	778-788	11	37
β-strand	794-795	2	37
α-helix	796-798	3
β-strand	799-804	6	37
α-helix	805-808	4
β-strand	819-822	4	38
β-strand	828-831	4	38
β-strand	842-851	10	39
β-strand	857-862	6	39
α-helix	863-869	7
β-strand	872-874	3	38
α-helix	877-878	2
β-strand	880-890	11	39
β-strand	894	1	39
α-helix	897-900	4
β-strand	901-905	5	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab 83-7 heavy chain	A	protein	219	Mus musculus	U5LP42 (AlphaFold model)
Fab 83-7 light chain	B	protein	219	Mus musculus	P01837 (AlphaFold model)
Fab 83-14 heavy chain	C	protein	220	Mus musculus	P01865 (AlphaFold model)
Fab 83-14 light chain	D	protein	214	Mus musculus	A2P1G9 (AlphaFold model)
Insulin receptor	E	protein	894	Homo sapiens	P06213

Sequence of entity 1 (A), FASTA

>4ZXB_1 Fab 83-7 heavy chain (chains A)
QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYN
SALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTVSSAK
TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD

Sequence of entity 2 (B), FASTA

>4ZXB_2 Fab 83-7 light chain (chains B)
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (C), FASTA

>4ZXB_3 Fab 83-14 heavy chain (chains C)
QVQLQQSGPELVKPGALVKISCKASGYTFTNYDIHWVKQRPGQGLEWIGWIYPGDGSTKY
NEKFKGKATLTADKSSSTAYMHLSSLTSEKSAVYFCAREWAYWGQGTLVTVSAAKTTAPS
VYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSS
VTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPC

Sequence of entity 4 (D), FASTA

>4ZXB_4 Fab 83-14 light chain (chains D)
DIQMTQSPSSLSASLGERVSLTCRASQDIGGNLYWLQQGPDGTIKRLIYATSSLDSGVPK
RFSGSRSGSDYSLTISSLESEDFVDYYCLQYSSSPWTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRGEC

Sequence of entity 5 (E), FASTA

>4ZXB_5 Insulin receptor (chains E)
HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDY
LLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIE
KNNELCYLATIDWSRILDSVEDNHIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVE
RCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVET
CPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLL
CTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGL
IEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLT
ITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRT
SFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRS
NDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLD
PISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSP
PFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSS
LGDVGNAGNNEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSA
RTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSR
KHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain. Croll, T.I., Smith, B.J., Margetts, M.B. et al. Structure (2016) 24:469-476. DOI 10.1016/j.str.2015.12.014 · PubMed

Other PDB entries of the same protein (UniProt U5LP42 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZDW 3.45 Å, The cryoEM structure of H5N1 HA split from symmetric filament in conformation A

Browse structure collections

About this viewer

MolViewer shows 4ZXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.