Structure-based energetics of protein interfaces guide Foot-and-Mouth disease virus vaccine design. Determined by electron microscopy at 3.2 Å resolution. Released 23 Sept 2015.
Explore 5AC9 in 3D Show helices and sheets RCSB PDB PDBe
5AC9 contains 24 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11 | 1 | 1 |
| β-strand | 17 | 1 | 2 |
| β-strand | 19 | 1 | 2 |
| α-helix | 28-30 | 3 | |
| α-helix | 32-35 | 4 | |
| β-strand | 40-42 | 3 | 3 |
| β-strand | 49-50 | 2 | 4 |
| α-helix | 61-66 | 6 | |
| β-strand | 69-75 | 7 | 5 |
| β-strand | 76-83 | 8 | 3 |
| β-strand | 86-89 | 4 | 4 |
| α-helix | 95-99 | 5 | |
| β-strand | 105-106 | 2 | 4 |
| β-strand | 113-117 | 5 | 3 |
| β-strand | 126-127 | 2 | 5 |
| β-strand | 167-169 | 3 | 4 |
| β-strand | 172-178 | 7 | 3 |
| β-strand | 181-188 | 8 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13 | 1 | 6 |
| β-strand | 17 | 1 | 7 |
| β-strand | 24 | 1 | 7 |
| β-strand | 28 | 1 | 6 |
| α-helix | 32 | 1 | |
| β-strand | 33-34 | 2 | 8 |
| α-helix | 35 | 1 | |
| α-helix | 46-48 | 3 | |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 56-58 | 3 | |
| β-strand | 62-70 | 9 | 8 |
| β-strand | 79-83 | 5 | 9 |
| α-helix | 90-95 | 6 | |
| β-strand | 98-110 | 13 | 8 |
| β-strand | 118 | 1 | 10 |
| β-strand | 121-127 | 7 | 9 |
| α-helix | 135-142 | 8 | |
| β-strand | 145-148 | 4 | 9 |
| β-strand | 155-160 | 6 | 8 |
| β-strand | 169 | 1 | 8 |
| β-strand | 177-183 | 7 | 9 |
| β-strand | 188 | 1 | 10 |
| β-strand | 196-213 | 18 | 8 |
| α-helix | 214-216 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 4 |
| α-helix | 20-24 | 5 | |
| α-helix | 31-33 | 3 | |
| α-helix | 44-50 | 7 | |
| β-strand | 53-54 | 2 | 11 |
| β-strand | 57 | 1 | 12 |
| β-strand | 61 | 1 | 12 |
| β-strand | 63-65 | 3 | 11 |
| β-strand | 73-78 | 6 | 13 |
| α-helix | 90-95 | 6 | |
| β-strand | 98-102 | 5 | 14 |
| α-helix | 104 | 1 | |
| β-strand | 105-111 | 7 | 11 |
| β-strand | 118-126 | 9 | 13 |
| α-helix | 127 | 1 | |
| α-helix | 131-133 | 3 | |
| α-helix | 136-139 | 4 | |
| β-strand | 145-148 | 4 | 13 |
| β-strand | 154-156 | 3 | 11 |
| α-helix | 158 | 1 | |
| β-strand | 159 | 1 | 11 |
| α-helix | 160-161 | 2 | |
| β-strand | 168-169 | 2 | 14 |
| β-strand | 183-192 | 10 | 13 |
| β-strand | 198-205 | 8 | 11 |
| β-strand | 210-214 | 5 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-24 | 2 | |
| α-helix | 33-35 | 3 | |
| α-helix | 67-73 | 7 | |
| β-strand | 76 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| VP1 | 1 | protein | 208 | FOOT-AND-MOUTH DISEASE VIRUS - TYPE O | Q6PMW3 |
| VP3 | 2 | protein | 218 | FOOT-AND-MOUTH DISEASE VIRUS - TYPE O | Q6PMW3 |
| VP2 | 3 | protein | 220 | FOOT-AND-MOUTH DISEASE VIRUS - TYPE O | Q6PMW3 |
| VP4 | 4 | protein | 85 | FOOT-AND-MOUTH DISEASE VIRUS - TYPE O | Q6PMW3 |
>5AC9_1 VP1 (chains 1) TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYT APHRVLATVYNGESKYGDGTVANVRGDLQVLAQKAARALPTSFNYGAIKATRVTELLYRM KRAETYCPRPLLAIHPDQARHKQKIVAP
>5AC9_2 VP3 (chains 2) DKKTEETTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVAQAER FFKTHLFDWVTSDPFGRCHLLELPTDHKGVYGYLTDSYAYMRNGWDVEVTAVGNQFNGGC LLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLV VMVVAPLTVNSEGAPQIKVYANIAPTNVHVAGEFPSKE
>5AC9_3 VP2 (chains 3) GIFPVACSDGYGGLVTTDPKTADPAYGKVFNPPRNMLPGRFTNFLDVAEACPTFLHFEGD VPYVTTKTDSDRVLAQFDLSLAAKHMSNTFLAGLAQYYTQYSGTINLHFMFTGPTDAKAR YMIAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFTFSIPYLSAADYTYTASDVAETTNV QGWVCLFQITHGKADGDALVVLASAGKDFELRLPVDARTQ
>5AC9_4 VP4 (chains 4) GAGQSSPATGSQNQSGNTGSIINNYYMQQYQNSMDTQLGDNATSGGSNEGSTDTTSTHTT NTQNNDWFSKLASSAFSGLFGALLA
Structure-Based Energetics of Protein Interfaces Guide Foot-and-Mouth Disease Vaccine Design. Kotecha, A., Seago, J., Scott, K. et al. Nat Struct Mol Biol (2015) 22:788. DOI 10.1038/NSMB.3096 · PubMed
Other PDB entries of the same protein (UniProt Q6PMW3), best resolution first:
MolViewer shows 5AC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.