Crystal structure of VDR-LBD complexed with 2-methylidene-19-nor-1a,25-dihydroxyvitamin D3. Determined by X-ray diffraction at 1.89 Å resolution. Released 7 Dec 2016.
Explore 5B41 in 3D Show helices and sheets RCSB PDB PDBe
5B41 contains 14 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 126-142 | 17 | |
| α-helix | 148-152 | 5 | |
| α-helix | 154-156 | 3 | |
| α-helix | 223-242 | 20 | |
| α-helix | 252-270 | 19 | |
| α-helix | 271-273 | 3 | |
| β-strand | 275-276 | 2 | 1 |
| β-strand | 281-283 | 3 | 1 |
| β-strand | 290-291 | 2 | 1 |
| α-helix | 293-297 | 5 | |
| α-helix | 303-319 | 17 | |
| α-helix | 323-334 | 12 | |
| α-helix | 345-366 | 22 | |
| α-helix | 375-402 | 28 | |
| α-helix | 404-407 | 4 | |
| α-helix | 412-418 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 628-634 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vitamin D3 receptor | A | protein | 271 | Rattus norvegicus | P13053 (AlphaFold model) |
| Mediator of RNA polymerase II transcription subunit 1 | C | protein | 13 | Homo sapiens | Q15648 (AlphaFold model) |
>5B41_1 Vitamin D3 receptor (chains A) GSHMGSPNSPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGS VTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSN QSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAI CIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEE HSKQYRSLSFQPENSMKLTPLVLEVFGNEIS
>5B41_2 Mediator of RNA polymerase II transcription subunit 1 (chains C) KNHPMLMNLLKDN
| ID | Name | Formula | Copies |
|---|---|---|---|
| YSV | (1R,3R)-5-(2-((1R,3aS,7aR,E)-1-((R)-6-hydroxy-6-methylheptan-2-yl)-7a-methyloct… | C27 H44 O3 | 1 |
Apo- and Antagonist-Binding Structures of Vitamin D Receptor Ligand-Binding Domain Revealed by Hybrid Approach Combining Small-Angle X-ray Scattering and Molecular Dynamics. Anami, Y., Shimizu, N., Ekimoto, T. et al. J Med Chem (2016) 59:7888-7900. DOI 10.1021/acs.jmedchem.6b00682 · PubMed
Other PDB entries of the same protein (UniProt P13053 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5B41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.