5B5V: Full-length MOB1b

Structure of full-length MOB1b. Determined by X-ray diffraction at 2.19 Å resolution. Released 6 Jul 2016.

Method: X-ray diffraction
Resolution: 2.19 Å
Organism: Mus musculus
Chains: 6
Atoms: 6,325
Mol. weight: 151.99 kDa
Ligands: ZN
Released: 6 Jul 2016

Explore 5B5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5B5V contains 49 α-helices and 12 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
α-helix	35-38	4
α-helix	41-44	4
α-helix	53-74	22
β-strand	87-88	2	1
β-strand	94-98	5	1
β-strand	107	1	1
α-helix	111-126	16
α-helix	139-141	3
α-helix	144-173	30
α-helix	176-193	18
α-helix	198-201	4
α-helix	202-204	3
α-helix	205-209	5

Chain B: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	24-35	12
α-helix	36-38	3
α-helix	41-44	4
α-helix	47-48	2
α-helix	53-74	22
α-helix	76-78	3
β-strand	87-88	2	2
β-strand	94-95	2	2
α-helix	111-126	16
α-helix	139-141	3
α-helix	144-165	22
α-helix	167-172	6
α-helix	176-192	17
α-helix	198-201	4
α-helix	202-204	3
α-helix	205-211	7

Chain D: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	24-35	12
α-helix	36-38	3
α-helix	41-44	4
α-helix	47-48	2
α-helix	53-74	22
α-helix	76-78	3
β-strand	87-88	2	4
β-strand	94-95	2	4
α-helix	111-126	16
α-helix	139-141	3
α-helix	144-165	22
α-helix	167-172	6
α-helix	176-192	17
α-helix	202-204	3
α-helix	205-209	5

Chains E and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5-9	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MOB kinase activator 1B	A, B, C, D, E, F	protein	218	Mus musculus	Q8BPB0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>5B5V_1 MOB kinase activator 1B (chains A, B, C, D, E, F)
GPMSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVA
VNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYL
MTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAH
LNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway. Kim, S.Y., Tachioka, Y., Mori, T. et al. Sci Rep (2016) 6:28488-28488. DOI 10.1038/srep28488 · PubMed

Other PDB entries of the same protein (UniProt Q8BPB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B5W 2.96 Å, Crystal structure of MOB1-LATS1 NTR domain complex
5B6B 3.54 Å, Complex of LATS1 and phosphomimetic MOB1b

Browse structure collections

About this viewer

MolViewer shows 5B5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.