5BS1: RbcX-IIa from Chlamydomonas reinhardtii

Name: PDB 5BS1: Crystal structure of RbcX-IIa from Chlamydomonas reinhardtii
Published: 2015-08-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of RbcX-IIa from Chlamydomonas reinhardtii. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Aug 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Chlamydomonas reinhardtii
Chains: 4
Atoms: 4,185
Mol. weight: 56.88 kDa
Ligands: MG
Released: 5 Aug 2015

Explore 5BS1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BS1 contains 27 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	36-38	3
α-helix	46-71	26
α-helix	79-92	14
α-helix	99-101	3
α-helix	102-111	10
α-helix	113-129	17
α-helix	132-154	23

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	37-39	3
α-helix	46-70	25
α-helix	79-92	14
α-helix	95-97	3
α-helix	102-111	10
α-helix	113-126	14
α-helix	132-154	23

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	36-38	3
α-helix	46-71	26
α-helix	80-92	13
α-helix	99-101	3
α-helix	102-111	10
α-helix	113-129	17
α-helix	132-153	22

Chain D: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	37-39	3
α-helix	46-70	25
α-helix	76-92	17
α-helix	102-111	10
α-helix	113-126	14
α-helix	132-153	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CrRbcX-IIa	A, B, C, D	protein	123	Chlamydomonas reinhardtii	A0A2K3E6P2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5BS1_1 CrRbcX-IIa (chains A, B, C, D)
MHIPADSFSGASPERKAAVALRSLFTFVAARVVLEQLQGPGGPETTYNQQAYLDLMDFLG
TPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRETREANTRLMRA
AAM

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii. Bracher, A., Hauser, T., Liu, C. et al. PLoS One (2015) 10:e0135448-e0135448. DOI 10.1371/journal.pone.0135448 · PubMed

Other PDB entries of the same protein (UniProt A0A2K3E6P2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BS2 1.97 Å, Crystal structure of RbcX-IIa from Chlamydomonas reinhardtii in complex with RbcL…

Browse structure collections

About this viewer

MolViewer shows 5BS1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.