5BS2: RbcX-IIa from Chlamydomonas reinhardtii

Name: PDB 5BS2: Crystal structure of RbcX-IIa from Chlamydomonas reinhardtii in complex with RbcL C-terminal tail
Published: 2015-08-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of RbcX-IIa from Chlamydomonas reinhardtii in complex with RbcL C-terminal tail. Determined by X-ray diffraction at 1.97 Å resolution. Released 5 Aug 2015.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Chlamydomonas reinhardtii
Chains: 3
Atoms: 1,887
Mol. weight: 30.69 kDa
Released: 5 Aug 2015

Explore 5BS2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BS2 contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	46-71	26
α-helix	79-92	14
α-helix	99-101	3
α-helix	102-111	10
α-helix	113-126	14
α-helix	132-154	23

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	46-70	25
α-helix	79-92	14
α-helix	102-111	10
α-helix	113-126	14
α-helix	132-154	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribulose bisphosphate carboxylase large chain,CrRbcX-IIa	A, B	protein	132	Chlamydomonas reinhardtii	A0A2K3E6P2 (AlphaFold model)
Ribulose bisphosphate carboxylase large chain	R	protein	6	Chlamydomonas reinhardtii	P00877 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5BS2_1 Ribulose bisphosphate carboxylase large chain,CrRbcX-IIa (chains A, B)
WKEIKFEFDTIDPADSFSGASPERKAAVALRSLFTFVAARVVLEQLQGPGGPETTYNQQA
YLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRETR
EANTRLMRAAAM

Sequence of entity 2 (R), FASTA

>5BS2_2 Ribulose bisphosphate carboxylase large chain (chains R)
WKEIKF

Primary citation

Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii. Bracher, A., Hauser, T., Liu, C. et al. PLoS One (2015) 10:e0135448-e0135448. DOI 10.1371/journal.pone.0135448 · PubMed

Other PDB entries of the same protein (UniProt A0A2K3E6P2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BS1 1.6 Å, Crystal structure of RbcX-IIa from Chlamydomonas reinhardtii

Browse structure collections

About this viewer

MolViewer shows 5BS2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.