5BXV: EIF4E complex

eIF4E complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 15 Jul 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 3,770
Mol. weight: 55.42 kDa
Ligands: MGP
Released: 15 Jul 2015

Explore 5BXV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BXV contains 28 α-helices and 19 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
β-strand	38-48	11	1
α-helix	57-59	3
β-strand	60-68	9	1
α-helix	69-76	8
β-strand	79	1	2
α-helix	82-84	3
α-helix	86	1
β-strand	90-95	6	1
β-strand	111-116	6	1
α-helix	119-121	3
α-helix	122-126	5
α-helix	127-139	13
α-helix	143-148	6
β-strand	149-155	7	1
β-strand	162-167	6	1
α-helix	173-187	15
β-strand	196-199	4	1
α-helix	200-203	4

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	56-62	7
α-helix	66-69	4
β-strand	82	1	2

Chain C: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	37	1
β-strand	38-48	11	3
α-helix	57-59	3
β-strand	60-68	9	3
α-helix	69-76	8
β-strand	79	1	4
α-helix	82-84	3
α-helix	86	1
β-strand	90-95	6	3
β-strand	111-116	6	3
α-helix	121	1
α-helix	122-126	5
α-helix	127-138	12
α-helix	143-148	6
β-strand	149-155	7	3
β-strand	162-167	6	3
α-helix	173-187	15
β-strand	196-199	4	3
α-helix	200-204	5
α-helix	211-213	3
β-strand	215-216	2	3

Chain D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	56-61	6
α-helix	62-64	3
α-helix	66-69	4
β-strand	82	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 4E	A, C	protein	192	Mus musculus	P63073 (AlphaFold model)
Eukaryotic translation initiation factor 4E-binding protein 1	B, D	protein	44	Homo sapiens	Q13541 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5BXV_1 Eukaryotic translation initiation factor 4E (chains A, C)
GEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNL
MPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDY
SDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTAT
KSGSTTKNRFVV

Sequence of entity 2 (B, D), FASTA

>5BXV_2 Eukaryotic translation initiation factor 4E-binding protein 1 (chains B, D)
GEFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSP

Ligands and cofactors

ID	Name	Formula	Copies
MGP	7-methyl-guanosine-5'-triphosphate	C11 H19 N5 O14 P3	2

Primary citation

Molecular mechanism of the dual activity of 4EGI-1: Dissociating eIF4G from eIF4E but stabilizing the binding of unphosphorylated 4E-BP1. Sekiyama, N., Arthanari, H., Papadopoulos, E. et al. Proc Natl Acad Sci U S A (2015) 112:E4036-E4045. DOI 10.1073/pnas.1512118112 · PubMed

Other PDB entries of the same protein (UniProt P63073 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M7X 1.68 Å, Translation initiation factor 4E in complex with (RP)-m2(7,2'O)GppSepG mRNA 5' cap…
5M7Z 1.69 Å, Translation initiation factor 4E in complex with (SP)-m2(7,2'O)GppSepG mRNA 5' cap…
5M7V 1.74 Å, Translation initiation factor 4E in complex with (RP)-m2(7,2'O)GppSpG mRNA 5' cap analog…
5J5Y 1.75 Å, Translation initiation factor 4E in complex with m2(7,2'O)GppCCl2ppG mRNA 5' cap analog
6U09 1.79 Å, Discovery of Lysine-Targeted eIF4E Inhibitors through Covalent Docking
1L8B 1.8 Å, Cocrystal Structure of the Messenger RNA 5' Cap-binding Protein (eIF4E) bound to…
5M84 1.85 Å, Translation initiation factor 4E in complex with (SP)-m2(7,2'O)GppSpA mRNA 5' cap analog
6GKK 1.86 Å, Translation initiation factor 4E in complex with beta-phosphorothioate trinucleotide…
5M83 1.86 Å, Translation initiation factor 4E in complex with (RP)-m2(7,2'O)GppSpA mRNA 5' cap analog
5J5O 1.87 Å, Translation initiation factor 4E in complex with m7GppppG mRNA 5' cap analog
5M81 1.9 Å, Translation initiation factor 4E in complex with (SP)-iPr-m7GppSpG mRNA 5' cap analog
5OSX 1.92 Å, Translation initiation factor 4E in complex with m7G(5'S)ppp(5'S)G mRNA 5' cap analog

Browse structure collections

About this viewer

MolViewer shows 5BXV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.