5BY4: Protein TolR

Structure and function of the Escherichia coli Tol-Pal stator protein TolR. Determined by X-ray diffraction at 1.7 Å resolution. Released 16 Sept 2015.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,039
Mol. weight: 11.77 kDa
Released: 16 Sept 2015

Explore 5BY4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BY4 contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	52-57	6
α-helix	62-63	2
β-strand	64-68	5	1
β-strand	74-78	5	1
β-strand	81-86	6	1
α-helix	88-101	14
β-strand	107-111	5	1
α-helix	117-129	13
β-strand	136-139	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein TolR	A	protein	110	Escherichia coli	P0ABV6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5BY4_1 Protein TolR (chains A)
GAMAPIITQSVEVDLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVV
AEVSSRFKANPKTVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI

Primary citation

Structure and Function of the Escherichia coli Tol-Pal Stator Protein TolR. Wojdyla, J.A., Cutts, E., Kaminska, R. et al. J Biol Chem (2015) 290:26675-26687. DOI 10.1074/jbc.M115.671586 · PubMed

Other PDB entries of the same protein (UniProt P0ABV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9O40 2.92 Å, cryo-EM structure of TolQR conformation1 in SMA nanodiscs
9DDM 2.94 Å, E. coli TolAQR conformation I
9DDN 3.18 Å, E. coli TolAQR conformation II
9KPZ 3.18 Å, Structure of TolQRA complex at pH 5.4 from E.coli
9QUQ 3.28 Å, cryo-EM structure of TolQR conformation2 in SMA nanodiscs
9QVD 3.52 Å, cryo-EM structure of TolQRA in nanodiscs
9K49 3.6 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…
9KQ0 3.6 Å, Structure of TolQRA complex at pH 8.0 from E.coli
9KCH 4.19 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…
8ODT 4.2 Å, Structure of TolQR complex from E.coli

Browse structure collections

About this viewer

MolViewer shows 5BY4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.