anti-CXCL13 parental scFv - 3B4. Determined by X-ray diffraction at 1.4 Å resolution. Released 4 Nov 2015.
Explore 5C2B in 3D Show helices and sheets RCSB PDB PDBe
5C2B contains 6 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 32-39 | 8 | 2 |
| β-strand | 45-52 | 8 | 2 |
| β-strand | 57-60 | 4 | 2 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-100 | 9 | 2 |
| β-strand | 101-104 | 4 | 3 |
| β-strand | 107-110 | 4 | 3 |
| β-strand | 116-117 | 2 | 2 |
| β-strand | 121-125 | 5 | 2 |
| α-helix | 126-127 | 2 | |
| β-strand | 1004 | 1 | 4 |
| β-strand | 1005 | 1 | 5 |
| β-strand | 1009-1012 | 4 | 6 |
| β-strand | 1018-1023 | 6 | 5 |
| β-strand | 1035-1040 | 6 | 6 |
| β-strand | 1047-1050 | 4 | 6 |
| β-strand | 1051 | 1 | 7 |
| β-strand | 1055 | 1 | 7 |
| α-helix | 1056-1057 | 2 | |
| β-strand | 1064-1069 | 6 | 5 |
| β-strand | 1072-1077 | 6 | 5 |
| α-helix | 1082-1084 | 3 | |
| β-strand | 1086-1093 | 8 | 6 |
| β-strand | 1099-1101 | 3 | 6 |
| β-strand | 1102 | 1 | 4 |
| β-strand | 1105-1109 | 5 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| scFv 3B4 | H | protein | 254 | Homo sapiens | A0A0B4J2H0 (AlphaFold model), A0A5C2GBJ8 (AlphaFold model) |
>5C2B_1 scFv 3B4 (chains H) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANY AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREPDYYDSSGYYPIDAFDIWGQG TTVTVSSGGGGSGGGGSGGGGSQSALTQPASVSASPGQSITISCTGTSSDVGAYDWVSWY QQHPGKAPKLLIFDVNNRPSGVSHRFSGSKSGNTASLTISGLQAEDEADYYCSSYTRRDT YVFGTGTKVTVLGE
Optimization of a scFv-based biotherapeutic by CDR side-chain clash repair. Tu, C., Terrabube, V., Tam, A. et al. To be published.
Other PDB entries of the same protein (UniProt A0A0B4J2H0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5C2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.