5C8H: ORC2 C-terminal domain

Crystal structure of ORC2 C-terminal domain. Determined by X-ray diffraction at 2.01 Å resolution. Released 8 Jul 2015.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 1
Atoms: 883
Mol. weight: 13.81 kDa
Released: 8 Jul 2015

Explore 5C8H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C8H contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	474-481	8
α-helix	486-501	16
β-strand	511-512	2	1
α-helix	513-522	10
α-helix	529-541	13
β-strand	546-549	4	1
β-strand	555-558	4	1
α-helix	563-572	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Origin recognition complex subunit 2	A	protein	121	Homo sapiens	Q13416 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5C8H_1 Origin recognition complex subunit 2 (chains A)
GTSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDF
YQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEE
A

Primary citation

Crystal structure of ORC2 C-terminal domain. Tempel, W., Xu, C., Dong, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q13416 (AlphaFold model), which also has an AlphaFold model), best resolution first:

11RL 2.8 Å, CryoEM structure of the human origin recognition complex with DNA and CDC6 protein
7JPO 3.2 Å, ORC-O1AAA: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC2 WH
7JPQ 3.5 Å, ORC-O2-5: Human Origin Recognition Complex (ORC) with subunits 2,3,4,5
8S0D 3.6 Å, H. sapiens MCM bound to double stranded DNA and ORC1-6
7JPP 3.7 Å, ORC-O2WH: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC1 AAA+ domain
7CTE 3.8 Å, Human Origin Recognition Complex, ORC2-5
8S0E 3.8 Å, H. sapiens OCCM bound to double stranded DNA
7JPR 4.0 Å, ORC-OPEN: Human Origin Recognition Complex (ORC) in an open conformation
8S0C 4.0 Å, H. sapiens ORC1-5 bound to double stranded DNA as part of the MCM-ORC complex
8S0F 4.1 Å, H. sapiens OC1M bound to double stranded DNA
7JPS 4.4 Å, ORC-DNA: Human Origin Recognition Complex (ORC) with DNA bound in the core
7CTF 4.8 Å, Human origin recognition complex 1-5 State II

Browse structure collections

About this viewer

MolViewer shows 5C8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.