5CBN: Maltose-binding periplasmic protein

Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with chemical cross-linker EY-CBS. Determined by X-ray diffraction at 2.3 Å resolution. Released 30 Mar 2016.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Escherichia coli (strain K12), synthetic construct, Staphylococcus aureus
Chains: 2
Atoms: 4,295
Mol. weight: 60.21 kDa
Ligands: EYC
Released: 30 Mar 2016

Explore 5CBN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CBN contains 35 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	27-35	9
α-helix	50-57	8
α-helix	60-68	9
α-helix	83-89	7
α-helix	93-101	9
α-helix	116-122	7
α-helix	126-1229	22
α-helix	1235-1246	12
α-helix	1252-1265	14

Chain B: 25 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
α-helix	17-31	15
β-strand	35-38	4	1
α-helix	43-51	9
β-strand	59-63	5	1
α-helix	64-66	3
α-helix	67-72	6
β-strand	76	1	2
α-helix	77-79	3
α-helix	83-86	4
β-strand	89	1	3
α-helix	91-95	5
β-strand	98-99	2	4
β-strand	102-103	2	4
β-strand	106-111	6	1
β-strand	114-118	5	5
β-strand	128	1	6
α-helix	129-131	3
α-helix	132-141	10
β-strand	145-147	3	5
α-helix	154-161	8
β-strand	167	1	7
β-strand	170	1	8
α-helix	172-174	3
β-strand	177	1	8
β-strand	182	1	7
α-helix	186-200	15
α-helix	210-218	9
β-strand	222-227	6	5
α-helix	229-231	3
α-helix	232-238	7
β-strand	242-245	4	5
α-helix	246-248	3
β-strand	249	1	6
β-strand	250	1	9
β-strand	253	1	9
α-helix	254-255	2
β-strand	258-259	2	10
β-strand	260-266	7	1
β-strand	267	1	2
α-helix	273-279	7
α-helix	280-284	5
α-helix	287-296	10
β-strand	301-302	2	1
β-strand	304	1	3
α-helix	305-311	7
α-helix	315-326	12
β-strand	328-329	2	10
α-helix	330-331	2
α-helix	336-352	17
α-helix	357-363	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein	B	protein	369	Escherichia coli (strain K12)	P0AEX9 (AlphaFold model)
mbp3-16,Immunoglobulin G-binding protein A	A	protein	176	synthetic construct, Staphylococcus aureus	P38507 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>5CBN_1 Maltose-binding periplasmic protein (chains B)
MGMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGP
DIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY
NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYD
IKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDT
SKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDK
PLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTV
DEALKDAQT

Sequence of entity 2 (A), FASTA

>5CBN_2 mbp3-16,Immunoglobulin G-binding protein A (chains A)
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGA
DVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEI
LCKNKAQQAAFYCILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Ligands and cofactors

ID	Name	Formula	Copies
EYC	2,2'-ethyne-1,2-diylbis{5-[(chloroacetyl)amino]benzenesulfonic acid}	C18 H14 Cl2 N2 O8 S2	1

Primary citation

Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker. Jeong, W.H., Lee, H., Song, D.H. et al. Nat Commun (2016) 7:11031-11031. DOI 10.1038/ncomms11031 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 5CBN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.