5CC0: AncSR2 - TSLP nGRE complex

AncSR2 - TSLP nGRE complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Dec 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: synthetic construct, Homo sapiens
Chains: 4
Atoms: 1,751
Mol. weight: 28.68 kDa
Ligands: ZN
Released: 23 Dec 2015

Explore 5CC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CC0 contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	430-432	3	1
β-strand	435-437	3	1
α-helix	439-450	12
α-helix	474-483	10

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	420	1	2
β-strand	427	1	2
β-strand	430-432	3	3
β-strand	435-437	3	3
α-helix	439-450	12
α-helix	474-483	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AncSR2 DNA Binding Domain	A, B	protein	85	synthetic construct	P06401 (AlphaFold model)
DNA (5'-d(cpgpcpcptpcpcpgpgpgpapgpapgpcpt)-3')	C	DNA	16	Homo sapiens
DNA (5'-d(apgpcptpcptpcpcpcpgpgpapgpgpcpg)-3')	D	DNA	16	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>5CC0_1 AncSR2 DNA Binding Domain (chains A, B)
SNASPPQKVCLICGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRK
NCPACRLRKCLQAGMTLGARKSKKL

Sequence of entity 2 (C), FASTA

>5CC0_2 DNA (5'-D(*CP*GP*CP*CP*TP*CP*CP*GP*GP*GP*AP*GP*AP*GP*CP*T)-3') (chains C)
CGCCTCCGGGAGAGCT

Sequence of entity 3 (D), FASTA

>5CC0_3 DNA (5'-D(*AP*GP*CP*TP*CP*TP*CP*CP*CP*GP*GP*AP*GP*GP*CP*G)-3') (chains D)
AGCTCTCCCGGAGGCG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space. Hudson, W.H., Kossmann, B.R., de Vera, I.M. et al. Proc Natl Acad Sci U S A (2016) 113:326-331. DOI 10.1073/pnas.1518960113 · PubMed

Other PDB entries of the same protein (UniProt P06401 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SQN 1.45 Å, Progesterone Receptor Ligand Binding Domain with bound Norethindrone
1SR7 1.46 Å, Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate
3ZR7 1.65 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
1A28 1.8 Å, Hormone-bound human progesterone receptor ligand-binding domain
2W8Y 1.8 Å, RU486 bound to the progesterone receptor in a destabilized agonistic conformation
3ZRB 1.8 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
3G8O 1.9 Å, Progesterone Receptor with bound Pyrrolidine 1
3ZRA 1.9 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
4APU 1.9 Å, PR X-Ray structures in agonist conformations reveal two different mechanisms for partial…
1ZUC 2.0 Å, Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist…
2OVH 2.0 Å, Progesterone Receptor with Bound Asoprisnil and a Peptide from the Co-Repressor SMRT
3KBA 2.0 Å, Progesterone receptor bound to sulfonamide pyrrolidine partial agonist

Browse structure collections

About this viewer

MolViewer shows 5CC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.