5CEK: Pseudokinase domain of Human Tribbles Homolog 1

Pseudokinase domain of Human Tribbles Homolog 1. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Nov 2015.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,919
Mol. weight: 29.96 kDa
Released: 11 Nov 2015

Explore 5CEK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CEK contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	89-91	3	1
β-strand	94-97	4	1
β-strand	105-110	6	1
β-strand	116-123	8	1
α-helix	124-126	3
α-helix	127-131	5
α-helix	132-135	4
β-strand	146-151	6	1
β-strand	155-160	6	1
α-helix	161-163	3
β-strand	166	1	2
α-helix	167-173	7
α-helix	179-198	20
α-helix	208-210	3
β-strand	211-213	3	2
β-strand	221-223	3	2
α-helix	251-255	5
α-helix	263-279	17
α-helix	289-297	9
α-helix	309-318	10
α-helix	323-325	3
α-helix	327-328	2
α-helix	329-332	4
α-helix	336-341	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tribbles homolog 1	A	protein	263	Homo sapiens	Q96RU8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5CEK_1 Tribbles homolog 1 (chains A)
GPGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH
SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSA
IVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTY
SGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLR
REPSERLTAPEILLHPWFESVLE

Primary citation

Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. Murphy, J.M., Nakatani, Y., Jamieson, S.A. et al. Structure (2015) 23:2111-2121. DOI 10.1016/j.str.2015.08.017 · PubMed

Other PDB entries of the same protein (UniProt Q96RU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IGO 1.6 Å, WD40 domain of Arabidopsis thaliana E3 Ubiquitin Ligase COP1 in complex with peptide…
5CEM 2.1 Å, Pseudokinase and C-terminal extension of Human Tribbles Homolog 1
6DC0 2.8 Å, Tribbles (TRIB1) pseudokinase fused to CCAAT-enhancer binding protein (C/EBPalpha) degron
5IGQ 3.9 Å, WD40 domain of Human E3 Ubiquitin Ligase COP1 (RFWD2) bound to peptide from Trib1

Browse structure collections

About this viewer

MolViewer shows 5CEK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.