Pseudokinase domain of Human Tribbles Homolog 1. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Nov 2015.
Explore 5CEK in 3D Show helices and sheets RCSB PDB PDBe
5CEK contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 89-91 | 3 | 1 |
| β-strand | 94-97 | 4 | 1 |
| β-strand | 105-110 | 6 | 1 |
| β-strand | 116-123 | 8 | 1 |
| α-helix | 124-126 | 3 | |
| α-helix | 127-131 | 5 | |
| α-helix | 132-135 | 4 | |
| β-strand | 146-151 | 6 | 1 |
| β-strand | 155-160 | 6 | 1 |
| α-helix | 161-163 | 3 | |
| β-strand | 166 | 1 | 2 |
| α-helix | 167-173 | 7 | |
| α-helix | 179-198 | 20 | |
| α-helix | 208-210 | 3 | |
| β-strand | 211-213 | 3 | 2 |
| β-strand | 221-223 | 3 | 2 |
| α-helix | 251-255 | 5 | |
| α-helix | 263-279 | 17 | |
| α-helix | 289-297 | 9 | |
| α-helix | 309-318 | 10 | |
| α-helix | 323-325 | 3 | |
| α-helix | 327-328 | 2 | |
| α-helix | 329-332 | 4 | |
| α-helix | 336-341 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tribbles homolog 1 | A | protein | 263 | Homo sapiens | Q96RU8 (AlphaFold model) |
>5CEK_1 Tribbles homolog 1 (chains A) GPGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSA IVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTY SGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLR REPSERLTAPEILLHPWFESVLE
Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. Murphy, J.M., Nakatani, Y., Jamieson, S.A. et al. Structure (2015) 23:2111-2121. DOI 10.1016/j.str.2015.08.017 · PubMed
Other PDB entries of the same protein (UniProt Q96RU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CEK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.