Crystal structures of Bbp from Staphylococcus aureus. Determined by X-ray diffraction at 2.03 Å resolution. Released 23 Sept 2015.
Explore 5CF3 in 3D Show helices and sheets RCSB PDB PDBe
5CF3 contains 7 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 1 |
| α-helix | 6-8 | 3 | |
| β-strand | 9-18 | 10 | 2 |
| β-strand | 25-27 | 3 | 1 |
| α-helix | 28-30 | 3 | |
| α-helix | 32-33 | 2 | |
| β-strand | 34-42 | 9 | 2 |
| β-strand | 51-55 | 5 | 1 |
| β-strand | 60-61 | 2 | 3 |
| α-helix | 70-73 | 4 | |
| β-strand | 74-75 | 2 | 1 |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 93-98 | 6 | 1 |
| α-helix | 101-104 | 4 | |
| β-strand | 108-116 | 9 | 2 |
| β-strand | 117-118 | 2 | 3 |
| β-strand | 127-135 | 9 | 1 |
| β-strand | 138-147 | 10 | 1 |
| β-strand | 152-154 | 3 | 4 |
| β-strand | 157-167 | 11 | 4 |
| β-strand | 172-179 | 8 | 4 |
| β-strand | 186-195 | 10 | 5 |
| β-strand | 197-198 | 2 | 6 |
| β-strand | 204-205 | 2 | 6 |
| β-strand | 212 | 1 | 4 |
| β-strand | 218-223 | 6 | 4 |
| α-helix | 239-241 | 3 | |
| β-strand | 243-244 | 2 | 4 |
| β-strand | 250-256 | 7 | 5 |
| β-strand | 259-267 | 9 | 5 |
| β-strand | 271-278 | 8 | 4 |
| α-helix | 280-282 | 3 | |
| β-strand | 288-298 | 11 | 5 |
| β-strand | 304-314 | 11 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bone sialoprotein-binding protein | A | protein | 331 | Staphylococcus aureus | Q14U76 (AlphaFold model) |
>5CF3_1 Bone sialoprotein-binding protein (chains A) GPLGSNNVNDLITVTKQMITEGIKDDGVIQAHDGEHIIYTSDFKIDNAVKAGDTMTVKYD KHTIPSDITDDFTPVDITDPSGEVIAKGTFDLNTKTITYKFTDYVDRYENVNAKLELNSY IDKKEVPNETNLNLTFATADKETSKNVKVEYQKPIVKDESNIQSIFSHLDTTKHEVEQTI YVNPLKLNAKNTNVTIKSGGVADNGDYYTGDGSTIIDSNTEIKVYKVASGQQLPQSNKIY DYSQYEDVTNSVTINKNYGTNMANINFGDIDSAYIVKVVSKYTPGAEDDLAVQQGVRMTT TNKYNYSSYAGYTNTILSTTDSGGGDGTVKP
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Crystal structures of Bbp from Staphylococcus aureus reveal the ligand binding mechanism with Fibrinogen alpha. Zhang, X.Y., Wu, M., Zhuo, W. et al. Protein Cell (2015) 6:757-766. DOI 10.1007/s13238-015-0205-x · PubMed
Other PDB entries of the same protein (UniProt Q14U76 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CF3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.